FC930820

Overview
NameFC930820
Unique NameFC930820
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length511
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:4..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_MAGLI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.785e-59
Identity = 70/91 (76.92%), Postives = 72/91 (79.12%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKHHELKVKD KTLLFGEKPVTVFGVRNPEEIPW ETGAE+VVESTGVFT               VIISAPSKDAPMFVVGVNEHEYK  +
Sbjct:   58 WKHHELKVKDSKTLLFGEKPVTVFGVRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKSNI 148          

HSP 2 Score: 105.531 bits (262), Expect = 4.785e-59
Identity = 50/52 (96.15%), Postives = 51/52 (98.08%), Query Frame = 3
Query:   81 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFITTDYMTYMFKYDSVHG
Sbjct:    5 KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 56          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3P_ATRNU (Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.382e-58
Identity = 69/91 (75.82%), Postives = 73/91 (80.22%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKHHELKVKD+KTLLFGE+PVTVFG RNPEEIPW +TGA+YVVESTGVFT               VIISAPSKDAPMFVVGVNEHEYK EL
Sbjct:   56 WKHHELKVKDEKTLLFGERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKSEL 146          

HSP 2 Score: 105.145 bits (261), Expect = 1.382e-58
Identity = 50/54 (92.59%), Postives = 51/54 (94.44%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            M KVKIGINGFGRIGRLVARVILQ DD ELVA+NDPFITTDYMTYMFKYDSVHG
Sbjct:    1 MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHG 54          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_ARATH (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Arabidopsis thaliana GN=GAPC PE=2 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 6.791e-58
Identity = 66/91 (72.53%), Postives = 74/91 (81.32%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKH+ELK+KD+KTLLFGEKPVTVFG+RNPE+IPWAE GA+YVVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:   58 WKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 148          

HSP 2 Score: 104.375 bits (259), Expect = 6.791e-58
Identity = 48/52 (92.31%), Postives = 52/52 (100.00%), Query Frame = 3
Query:   81 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYMFKYDSVHG
Sbjct:    5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHG 56          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_PETHY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.335e-57
Identity = 68/91 (74.73%), Postives = 71/91 (78.02%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKHHELK KDDKTLLFGEKPVTVFG+RNPEEIPW E GA+YVVESTGVFT               VIISAPSKDAPMFVVGVNE EYK +L
Sbjct:   56 WKHHELKAKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKEYKSDL 146          

HSP 2 Score: 102.449 bits (254), Expect = 3.335e-57
Identity = 48/54 (88.89%), Postives = 51/54 (94.44%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            M K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFI+ +YMTYMFKYDSVHG
Sbjct:    1 MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHG 54          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_DIACA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 5.669e-57
Identity = 68/91 (74.73%), Postives = 72/91 (79.12%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKHH++KVKD+KTLLFGEK VTVFG RNPEEIPW  TGA+YVVESTGVFT               VIISAPSKDAPMFVVGVNEHEYKPEL
Sbjct:   56 WKHHDIKVKDEKTLLFGEKAVTVFGNRNPEEIPWGGTGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKPEL 146          

HSP 2 Score: 102.064 bits (253), Expect = 5.669e-57
Identity = 48/54 (88.89%), Postives = 51/54 (94.44%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            M  +KIGINGFGRIGRLVARVILQR+D ELVAVNDPFITT+YMTYMFKYDSVHG
Sbjct:    1 MAPIKIGINGFGRIGRLVARVILQREDCELVAVNDPFITTEYMTYMFKYDSVHG 54          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_SINAL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 5.669e-57
Identity = 65/91 (71.43%), Postives = 73/91 (80.22%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKH+ELKVKD+KTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:   58 WKHNELKVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 148          

HSP 2 Score: 103.99 bits (258), Expect = 5.669e-57
Identity = 49/52 (94.23%), Postives = 52/52 (100.00%), Query Frame = 3
Query:   81 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            K+KIGINGFGRIGRLVARVILQR+DVELVAVNDPFITT+YMTYMFKYDSVHG
Sbjct:    5 KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHG 56          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_RANAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.731e-56
Identity = 65/91 (71.43%), Postives = 70/91 (76.92%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKHHELKVKD+KTLLFGEKPVTVFG RNPEEIPW ETGAE+VVESTGVFT               V+ISAPS DAPMFVVGVN  EYK ++
Sbjct:   57 WKHHELKVKDEKTLLFGEKPVTVFGCRNPEEIPWGETGAEFVVESTGVFTTKEKASAHLKGGAKKVVISAPSADAPMFVVGVNHTEYKSDI 147          

HSP 2 Score: 104.375 bits (259), Expect = 4.731e-56
Identity = 49/53 (92.45%), Postives = 51/53 (96.23%), Query Frame = 3
Query:   78 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            GK+KIGINGFGRIGRLVARV L RDDVELVAVNDPFITTDYMTYMFKYD+VHG
Sbjct:    3 GKIKIGINGFGRIGRLVARVALARDDVELVAVNDPFITTDYMTYMFKYDTVHG 55          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_GINBI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.040e-56
Identity = 65/91 (71.43%), Postives = 69/91 (75.82%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WK HE+KVKD  TLLFGEK VTVFG RNPEEIPW ETG EYVVESTGVFT               V+I+APSKDAPMFVVGVNEHEYKP+L
Sbjct:   59 WKKHEVKVKDSNTLLFGEKAVTVFGCRNPEEIPWGETGVEYVVESTGVFTDKEKAAAHIKGGAKKVVITAPSKDAPMFVVGVNEHEYKPDL 149          

HSP 2 Score: 103.219 bits (256), Expect = 8.040e-56
Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 3
Query:   78 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            GK+KIGINGFGRIGRLVARV L RDD+ELVAVNDPFI+TDYMTYMFKYDSVHG
Sbjct:    5 GKIKIGINGFGRIGRLVARVALLRDDIELVAVNDPFISTDYMTYMFKYDSVHG 57          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PX_HORVU (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Hordeum vulgare GN=GAPC PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 8.041e-56
Identity = 62/91 (68.13%), Postives = 70/91 (76.92%), Query Frame = 2
Query:  239 WKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            WKH ++K+KDDKTLLFGEKPVTVFGVRNPEEIPW E GA+YVVESTGVFT               V+ISAPSKDAPMFVVGVNE +Y  ++
Sbjct:   56 WKHSDIKLKDDKTLLFGEKPVTVFGVRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEDKYTSDV 146          

HSP 2 Score: 107.842 bits (268), Expect = 8.041e-56
Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGH 239
            MGK+KIGINGFGRIGRLVARV LQ DDVELVAVNDPFITT+YMTYMFKYD+VHGH
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTEYMTYMFKYDTVHGH 55          
BLAST of FC930820 vs. ExPASy Swiss-Prot
Match: G3PC_ANTMA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.782e-55
Identity = 67/92 (72.83%), Postives = 71/92 (77.17%), Query Frame = 2
Query:  236 SWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 511
            +WKHHELKVKD+KTLLFGEKPV VFG RNPEEIP A TGAEY+VESTGVFT               VIISAPSKDAPMFVVGVNE EYK +L
Sbjct:   55 AWKHHELKVKDEKTLLFGEKPVVVFGRRNPEEIPRASTGAEYIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKEYKSDL 146          

HSP 2 Score: 103.605 bits (257), Expect = 1.782e-55
Identity = 49/54 (90.74%), Postives = 51/54 (94.44%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHG 236
            M  +KIGINGFGRIGRLVARV LQRDDVELVAVNDPFI+TDYMTYMFKYDSVHG
Sbjct:    1 MAPIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHG 54          
The following BLAST results are available for this feature:
BLAST of FC930820 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 225
Match NameE-valueIdentityDescription
G3PC_MAGLI4.785e-5976.92Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_ATRNU1.382e-5875.82Glyceraldehyde-3-phosphate dehydrogenase OS=Atripl... [more]
G3PC_ARATH6.791e-5872.53Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PETHY3.335e-5774.73Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_DIACA5.669e-5774.73Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_SINAL5.669e-5771.43Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_RANAC4.731e-5671.43Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_GINBI8.040e-5671.43Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PX_HORVU8.041e-5668.13Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ANTMA1.782e-5572.83Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34109D05EF PostHarvP1 Citrus clementina cDNA clone C34109D05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930820 ID=FC930820|Name=FC930820|organism=Citrus clementina|type=EST|length=511bp
ACACGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACC
GCTCAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAA
CGGATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGG
ACGATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTAC
ATGACATACATGTTTAAGTACGACAGTGTTCACGGTCATGGAAGCACCAT
GAATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGT
CACTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTG
GAGCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAG
GCTGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCC
CAGCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACA
AACCAGAGCTC
back to top