FC930824

Overview
NameFC930824
Unique NameFC930824
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig90 contig Ccv1_Contig90:124..810. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAHC_ARATH (Carbonic anhydrase, chloroplastic OS=Arabidopsis thaliana GN=CA1 PE=1 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 4.988e-69
Identity = 134/207 (64.73%), Postives = 150/207 (72.46%), Query Frame = 3
Query:   72 ADFVDKFLREDMANQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQT--PSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEHGDXPF 686
            A  +  +  E+M  ++Y                   VAAAKVEQITA LQT   SD KAFD VE IK+GFI FK+EKYE NPALY ELAKGQSPKYMVFACSDSRVCPSHVLDFQPG+AFVVRN+AN+VPP+D+ K            LHLKV NIVVIGHSACGGIKGLMSF  DGNNSTDFIEDWVKI +PA+SKV++E GD  F
Sbjct:   67 APIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQITAALQTGTSSDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFQPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVISELGDSAF 273          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAHC_TOBAC (Carbonic anhydrase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.669e-67
Identity = 126/202 (62.38%), Postives = 148/202 (73.27%), Query Frame = 3
Query:   81 VDKFLREDMANQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEHGDXPF 686
            ++  LRE+MA +SY                  P+AAA+V+QITA+LQ+   +K FD VE +K GFIHFK EKYEKNPALY EL+KGQSPK+MVFACSDSRVCPSHVL+FQPGEAFVVRN+AN+VP YD+T+            LHLKV NIVVIGHSACGGIKGLMS   DG+ ST FIEDWVKIG+PA++KV  EH D  F
Sbjct:   57 INPILREEMAKESYEQAIAALEKLLSEKGELGPIAAARVDQITAELQSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKFMVFACSDSRVCPSHVLNFQPGEAFVVRNIANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFIEDWVKIGLPAKAKVQGEHVDKCF 258          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAH2_ARATH (Carbonic anhydrase 2 OS=Arabidopsis thaliana GN=CA2 PE=1 SV=2)

HSP 1 Score: 253.062 bits (645), Expect = 1.040e-66
Identity = 129/196 (65.82%), Postives = 145/196 (73.98%), Query Frame = 3
Query:  105 MANQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQ--TPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEHGDXPF 686
            M N+SY                   VAAAKV++ITA+LQ  + SD+K+FD VERIKEGF+ FK+EKYE NPALY ELAKGQSPKYMVFACSDSRVCPSHVLDF PG+AFVVRN+AN+VPP+D+ K            LHLKV NIVVIGHSACGGIKGLMSF  DGNNSTDFIEDWVKI +PA+SKVL E     F
Sbjct:    1 MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVLAESESSAF 196          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAHC_PEA (Carbonic anhydrase, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.358e-66
Identity = 130/209 (62.20%), Postives = 148/209 (70.81%), Query Frame = 3
Query:   69 SADFVDKFLREDMANQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQTPSDTKAF---DSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEHGDXPF 686
            S+  +   LRE+M  + Y                    AA KVEQITAQL T S +      ++ ERIK GF+HFK+EKY+KNPALY ELAKGQSP +MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPPYDQ K            LHLKVSNIVVIGHSACGGIKGL+SF FDG  STDFIE+WVKIG+PA++KV  +HGD PF
Sbjct:   58 SSPIITPVLREEMG-KGYDEAIEELQKLLREKTELKATAAEKVEQITAQLGTTSSSDGIPKSEASERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYAGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFIEEWVKIGLPAKAKVKAQHGDAPF 265          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAHX_FLABR (Carbonic anhydrase OS=Flaveria brownii PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.000e-61
Identity = 116/187 (62.03%), Postives = 133/187 (71.12%), Query Frame = 3
Query:  111 NQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEH 671
            N+SY                  PVAAA+++QITAQ   P     FD VERIK GF+ FK EK+  NPALY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PA+SKV+ EH
Sbjct:   76 NESYEEAIDALKKMLIEKGELEPVAAARIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEH 262          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAH1_FLALI (Carbonic anhydrase 1 OS=Flaveria linearis PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.000e-61
Identity = 116/187 (62.03%), Postives = 133/187 (71.12%), Query Frame = 3
Query:  111 NQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEH 671
            N+SY                  PVAAA+++QITAQ   P     FD VERIK GF+ FK EK+  NPALY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PA+SKV+ EH
Sbjct:   76 NESYEEAIDALKKMLIEKGELEPVAAARIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEH 262          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAHX_FLAPR (Carbonic anhydrase OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.455e-60
Identity = 115/187 (61.50%), Postives = 132/187 (70.59%), Query Frame = 3
Query:  111 NQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEH 671
            N+SY                  PVAAA+++QITAQ   P     FD VERIK GF+ FK EK+  NP LY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PA+SKV+ EH
Sbjct:   75 NESYEEAIDALKKMLIEKGELEPVAAARIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPVLYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEH 261          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAHX_FLABI (Carbonic anhydrase OS=Flaveria bidentis PE=2 SV=2)

HSP 1 Score: 232.646 bits (592), Expect = 1.455e-60
Identity = 115/187 (61.50%), Postives = 132/187 (70.59%), Query Frame = 3
Query:  111 NQSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEH 671
            N+SY                  PVAA +++QITAQ   P     FD VERIK GF+ FK EK+  NPALY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PA+SKV+ EH
Sbjct:   76 NESYEEAIDALKKTLIEKGELEPVAATRIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEH 262          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAHC_SPIOL (Carbonic anhydrase, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 4.680e-59
Identity = 113/168 (67.26%), Postives = 130/168 (77.38%), Query Frame = 3
Query:  183 AAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKVLTEHGDXPF 686
            AA+KV QIT++L       A   V+RIKEGFI FK+EKYEKNPALY EL+KGQ+PK+MVFACSDSRVCPSHVLDFQPGEAF+VRN+AN+VP +D+ K            LHLKV NIVVIGHSACGGIKGLMSF   G  +TDFIEDWVKI +PA+ KVL EHG+  F
Sbjct:   89 AASKVAQITSELADGGTPSASYPVQRIKEGFIKFKKEKYEKNPALYGELSKGQAPKFMVFACSDSRVCPSHVLDFQPGEAFMVRNIANMVPVFDKDKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDAGPTTTDFIEDWVKICLPAKHKVLAEHGNATF 256          
BLAST of FC930824 vs. ExPASy Swiss-Prot
Match: CAH2_FLALI (Carbonic anhydrase 2 (Fragment) OS=Flaveria linearis PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.909e-44
Identity = 84/118 (71.19%), Postives = 94/118 (79.66%), Query Frame = 3
Query:  306 NPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAQSKV 659
            NP LY ELAKGQSPK++VFACSDSRVCPSH+LDFQPGEAFVVRN+AN+VPPYD  K            LHLKV NIVVIGHS CGGIKGLMS   DG  ++DFIE WVK+G+PA+SKV
Sbjct:    1 NPTLYGELAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFVVRNIANMVPPYDTIKHSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTPASDFIEQWVKLGLPAKSKV 118          
The following BLAST results are available for this feature:
BLAST of FC930824 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
CAHC_ARATH4.988e-6964.73Carbonic anhydrase, chloroplastic OS=Arabidopsis t... [more]
CAHC_TOBAC4.669e-6762.38Carbonic anhydrase, chloroplastic OS=Nicotiana tab... [more]
CAH2_ARATH1.040e-6665.82Carbonic anhydrase 2 OS=Arabidopsis thaliana GN=CA... [more]
CAHC_PEA1.358e-6662.20Carbonic anhydrase, chloroplastic OS=Pisum sativum... [more]
CAHX_FLABR5.000e-6162.03Carbonic anhydrase OS=Flaveria brownii PE=2 SV=1[more]
CAH1_FLALI5.000e-6162.03Carbonic anhydrase 1 OS=Flaveria linearis PE=2 SV=... [more]
CAHX_FLAPR1.455e-6061.50Carbonic anhydrase OS=Flaveria pringlei PE=2 SV=1[more]
CAHX_FLABI1.455e-6061.50Carbonic anhydrase OS=Flaveria bidentis PE=2 SV=2[more]
CAHC_SPIOL4.680e-5967.26Carbonic anhydrase, chloroplastic OS=Spinacia oler... [more]
CAH2_FLALI1.909e-4471.19Carbonic anhydrase 2 (Fragment) OS=Flaveria linear... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34109D09EF PostHarvP1 Citrus clementina cDNA clone C34109D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930824 ID=FC930824|Name=FC930824|organism=Citrus clementina|type=EST|length=687bp
GGATTCCACGAGTAATTAAAAGGATGACCAAGAAGCATATCTCCAATGGG
AGATGGTTATCTGATTTCAGTGCTGATTTTGTTGACAAATTTCTGAGGGA
AGACATGGCAAATCAGTCGTACGAGGAAGCCATTGAAGCTCTCAAGAAAC
TTCTCAAGGAGAAGGAAGACTTGAAACCTGTTGCTGCTGCAAAAGTAGAG
CAGATTACTGCGCAGCTACAGACTCCATCTGACACCAAAGCATTTGATTC
CGTGGAGAGGATCAAAGAGGGCTTCATTCACTTCAAGAGAGAAAAATACG
AGAAAAATCCAGCTCTGTACTCTGAGCTAGCCAAAGGCCAAAGCCCGAAG
TATATGGTATTTGCCTGCTCAGACTCCAGGGTTTGCCCGTCCCATGTGTT
GGATTTTCAACCTGGGGAAGCTTTCGTGGTTCGCAATGTTGCTAACATTG
TTCCACCCTATGATCAGACTAAATATGCTGGAGTTGGAGCTGCTGTCGAG
TATGCAGTTTTGCATCTCAAGGTTTCAAACATTGTGGTCATTGGGCACAG
CGCCTGTGGTGGCATCAAAGGACTCATGTCTTTCACATTTGATGGAAACA
ACTCCACCGATTTCATTGAAGACTGGGTGAAAATTGGCATCCCTGCCCAG
TCTAAGGTGTTAACAGAGCATGGTGACNAGCCTTTTG
back to top