FC930826

Overview
NameFC930826
Unique NameFC930826
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length709
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9406 contig Ccv1_Contig9406:81..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930826 vs. ExPASy Swiss-Prot
Match: APO2_ARATH (APO protein 2, chloroplastic OS=Arabidopsis thaliana GN=APO2 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.197e-44
Identity = 83/138 (60.14%), Postives = 103/138 (74.64%), Query Frame = 1
Query:  271 RVPSKKLQHPYALAARQDYPQNADLPRQYSKREKKPFPIPIVELXXXXXXXXKNRSGQPRRPVPPPKRGLLVKNLIPVAYDVLNARITLINNLKKLWKVVPVHACVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEWT 684
            RV   K +    L  R D PQN DLP+QY++REKKPFP+PIV+L        KN   +P+RP+PPPK G++VK+L+P+AY V NARI LINNL +L KVV V+AC +CNEIHVGP GH FKSCKGP+++ RKGLHEWT
Sbjct:   59 RVVLSKERRSLPLVVRNDRPQNEDLPKQYTRREKKPFPVPIVDLRRAARERVKNNKDKPKRPLPPPKNGMVVKSLVPLAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEWT 196          
BLAST of FC930826 vs. ExPASy Swiss-Prot
Match: APO1_ARATH (APO protein 1, chloroplastic OS=Arabidopsis thaliana GN=APO1 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.982e-20
Identity = 49/117 (41.88%), Postives = 64/117 (54.70%), Query Frame = 1
Query:  331 QNADLPRQYSKREKKPFPIPIVELXXXXXXXXKNRSGQPRRPVPPPKRGLLVKNLIPVAYDVLNARITLINNLKKLWKVVPVHACVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEW 681
            QN DLP    K +KKP+PIP  ++        K       + + PPK GLLV NL+PVA  V++    LI  L +L  VVPV AC  C  +HV  VGH  + C GP ++ R+G H W
Sbjct:   72 QNVDLPPILPKNKKKPYPIPFKQIQEEARKDKKLAQMGIEKQLDPPKNGLLVPNLVPVADQVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVANVGHNIRDCNGPTNSQRRGSHSW 188          
BLAST of FC930826 vs. ExPASy Swiss-Prot
Match: APO3_ARATH (APO protein 3, mitochondrial OS=Arabidopsis thaliana GN=APO3 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.779e-17
Identity = 48/120 (40.00%), Postives = 64/120 (53.33%), Query Frame = 1
Query:  328 PQNADLPRQ-YSKREKKPFPIPIVELXXXXXXXXKNRSGQPRRPVP-PPKRGLLVKNLIPVAYDVLNARITLINNLKKLWKVVPVHACVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEW 681
            P  AD+P+    K E+KP+P P+ EL        + R  QP R +  PP  GLLV  L+ VA+ V   R  L++ L K+   VPVH C  C E+H+G  GH  ++C GP S  R   H W
Sbjct:   41 PLYADVPKPPKDKSERKPYPTPMKELIRRAKEEKQLRKLQPCRVLEDPPDNGLLVPELVDVAHCVHRCRNMLLSGLSKIIHHVPVHRCRLCAEVHIGKQGHEIRTCTGPGSGSRSATHVW 160          
The following BLAST results are available for this feature:
BLAST of FC930826 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
APO2_ARATH1.197e-4460.14APO protein 2, chloroplastic OS=Arabidopsis thalia... [more]
APO1_ARATH5.982e-2041.88APO protein 1, chloroplastic OS=Arabidopsis thalia... [more]
APO3_ARATH2.779e-1740.00APO protein 3, mitochondrial OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34109D11EF PostHarvP1 Citrus clementina cDNA clone C34109D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930826 ID=FC930826|Name=FC930826|organism=Citrus clementina|type=EST|length=709bp
GCTAATAATTCAATGGACATAAATGCTCAGATATCACCGCAATATTTCTC
TTCATTTTGACACTTGCAAAATTTTGTTCTGGGTCTGCTAAAAGAAGTCC
CATTTTGGTAAATGGATTTATTATCTTGTGGCAAAGTAACAGTTTTCCCT
CAACCCAAAGCGGGAACCTCCATTTTTACACGGAATTCACGACTTAACCT
TCACTCAGGTCTTAGCTCTCTTCATTCTTTGAAGCTTAGTAGCGGAAAAT
ATAAACTTCAATTAAAGTCTAGAGTTCCATCGAAAAAGTTGCAGCATCCA
TATGCTTTGGCCGCTAGACAGGATTATCCGCAAAATGCAGATTTACCTCG
GCAGTACTCAAAGAGAGAAAAGAAGCCATTTCCAATTCCTATAGTGGAGC
TGAGGCGAGCTGCTAGAGCAAGGGCCAAAAATCGGAGTGGCCAACCCAGA
AGACCAGTCCCACCTCCAAAAAGAGGGTTGCTGGTTAAAAACCTTATACC
AGTGGCCTATGATGTGTTAAATGCGAGAATTACATTGATTAACAATCTCA
AGAAGCTCTGGAAAGTGGTGCCTGTGCATGCTTGCGTATTTTGTAATGAA
ATTCACGTGGGACCTGTTGGACATCGTTTCAAGTCATGCAAAGGCCCTGA
TTCTGCCTTTCGCAAGGGTCTTCATGAGTGGACAATGCAGCCCTTGAGAT
ATACTTTTG
back to top