FC930830

Overview
NameFC930830
Unique NameFC930830
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length717
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15223 contig Ccv1_Contig15223:1..717. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DCL4_ORYSJ (Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica GN=DCL4 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.854e-45
Identity = 98/211 (46.45%), Postives = 137/211 (64.93%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTREVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPS-LKKGGKFLAEAKVAVKDKDVFISACATNLSRKEAIRIASQQLFSKLKAAGYVPKTKSLESILKSSPKSEARLIGYDETPINVVA 631
            +TDLRS+ V N + A  AV++S +K LI DSN L+  I+ +  Y+   +S +++ E P CPK LGD+VES +GA+LLDSGFNLN VWK+ML  L P+L F+N+  NP+REL ELC  +  +L  P  +K  G++  + +V +K K   I   A N + K A + A+Q+  SKLK  GY  + KSLE IL  + K E+ LIGY+E PI+V A
Sbjct: 1279 ITDLRSLAVGNDSLAYAAVEKSIHKHLIKDSNHLTSAISKFEMYVKLSNSEKDLLEEPACPKALGDIVESCIGAVLLDSGFNLNYVWKVMLMLLKPVLTFANMHTNPMRELRELCQCHGFELGLPKPMKADGEYHVKVEVNIKSK--IIICTAANRNSKAARKFAAQETLSKLKNYGYKHRNKSLEEILIVARKRESELIGYNEDPIDVEA 1487          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DCL4_ARATH (Dicer-like protein 4 OS=Arabidopsis thaliana GN=DCL4 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.356e-24
Identity = 75/223 (33.63%), Postives = 107/223 (47.98%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTREVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVAVKDKDVFISACATNLSRKEAIRIASQQLFSKLKAAGYVPKTKSLESILKSSPKSEARLIGYDETPINVVAADDNVFEKLKISE 670
            LTDLRS+ VNN+A ANVAV  S  +FL  +S  L E I +Y +++ +        EGPRCPK+                                          +PI+EL+ELC SY  D +  + KK G F  E KV      + +SA   N  ++E  + A+Q + + LKA   +  +  LE +LK+  ++EA+LIGY+E PI+VV       E L I E
Sbjct: 1286 LTDLRSLSVNNEALANVAVSFSLKRFLFCESIYLHEVIEDYTNFLASSPLASGQSEGPRCPKI------------------------------------------SPIKELIELCQSYKWDREISATKKDGAFTVELKVTKNGCCLTVSATGRN--KREGTKKAAQLMITNLKAHENITTSHPLEDVLKNGIRNEAKLIGYNEDPIDVVDLVGLDVENLNILE 1464          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DCL3A_ORYSJ (Endoribonuclease Dicer homolog 3a OS=Oryza sativa subsp. japonica GN=DCL3A PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.416e-22
Identity = 81/241 (33.61%), Postives = 118/241 (48.96%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTRE--VKEG-PRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVAVKDKDVFISACATNLSRKEAIRIASQQLFSKLKAAGYV-----PKTKSLESILKSSPKSEARLIGYDETPINVVAADDNVFEKLKISEPQAVNYTLHV 700
            LTDLRS  VNN+ FA VAV  +F+ FL   S +L + I  YV+ +   S  +   + +G P+ PKVLGD+VES  GAILLD+  +L+ VW I    L PI+   NL+L P REL+E C  +   +      +G   +A   V +  K+V +     +  RK+A   AS  L   L+  G +      KT+  E    S+       +   +T       + N  +   IS+P  +   LHV
Sbjct: 1307 LTDLRSASVNNENFAQVAVKHNFHHFLQHSSGLLLDQITEYVNRLEGSSMDKVELLSDGLPKGPKVLGDIVESIAGAILLDTKLDLDVVWGIFEPLLSPIVTPENLELPPYRELIEWCGKHGYFVGINCRDQGDTVVATLDVQL--KEVLLVRQGFSKKRKDAKAHASSLLLKDLEEKGLIIPKNASKTEQFEKHCGSTNPFNNLHVDAMDTQTPKPTKEKNAADSRNISDP-LLGKPLHV 1544          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DCL3B_ORYSJ (Endoribonuclease Dicer homolog 3b OS=Oryza sativa subsp. japonica GN=DCL3B PE=2 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 2.980e-19
Identity = 61/179 (34.08%), Postives = 93/179 (51.96%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYV-DYMITPSSTREVKEGPRC--PKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVAVKDKDVFISACATNLSRKEAIRIASQQLFSKLKAAG 529
            LTDLRS LV+N+ FA   V  + +  L   S +L E I  YV   +       E  +   C  PKVLGD++ES  GA+ +D+ FN++ VW+I    L P++    L L P RELLELC+     L      KG + + E  + ++D+   + A   + ++K A   A+ ++ + LK  G
Sbjct: 1307 LTDLRSALVSNENFAQAVVRNNIHSHLQHGSGILLEQITEYVRSNLECQGKESEFLQHTTCKVPKVLGDIMESIAGAVFIDTDFNVDMVWEIFEPLLSPLITPDKLALPPYRELLELCSHIGCFLNSKCTSKGEEVIIEMSLQLRDE--LLVAQGHDRNKKRAKAKAASRILADLKQQG 1483          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DICER_ARATH (Endoribonuclease Dicer homolog OS=Arabidopsis thaliana GN=CAF PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 7.341e-18
Identity = 59/177 (33.33%), Postives = 87/177 (49.15%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTREVKE----GPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVAVKDKDVFISACATNLSRKEAIRIASQQLFSKLK 520
            LTDLR+  VNN+ FA VAV    + +L   S+ L + I  +V  + T SS            + PKVLGD+VES  GAI LDSG +    WK+    L P++    L ++P+REL E C      L++ + + G     E  +     D      A N  +K A ++A++   + LK
Sbjct: 1624 LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQAEGLEYKASRSGNTATVEVFI-----DGVQVGVAQNPQKKMAQKLAARNALAALK 1795          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DCL1_ORYSJ (Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica GN=DCL1 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.252e-17
Identity = 59/177 (33.33%), Postives = 91/177 (51.41%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYV----DYMITPSSTREVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVAVKDKDVFISACATNLSRKEAIRIASQQLFSKLK 520
            LTDLR+  VNN+ FA VAV    +  L   S+ L   I  +V    + ++ P          + PKVLGD+VES  GAI LDSG++ + VWK+    L P++    L ++P+REL E C      L++ + + G   +A  +V V    + +   A N  +K A ++A++     LK
Sbjct: 1603 LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELLKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKASRAGN--IATVEVFVDGVQIGV---AQNPQKKMAQKLAARNALVVLK 1774          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DCR1_DROME (Endoribonuclease Dcr-1 OS=Drosophila melanogaster GN=Dcr-1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.453e-15
Identity = 68/198 (34.34%), Postives = 94/198 (47.47%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYV------------DYMITPSSTREVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDP-ILKFSN-LQLNPIRELLELCNSYDLDLQFPSLKKGGK--FLAEAKVAVKDKDVFISACATNLSRKEAIR--IASQQLFSKLKAAGYVPK 541
            LTDLRS LVNN  FA++AV   F+KF    S  L++ I+ +V            +Y +      +  E    PK LGD+ ES  GAI LDS  +L+ VW +  + + P I +FSN +  +PIRELLEL          P   K GK   LA+ +      DVF       + R   I    A++    +LK  G + K
Sbjct: 2059 LTDLRSALVNNTIFASLAVRHGFHKFFRHLSPGLNDVIDRFVRIQQENGHCISEEYYLLSEEECDDAEDVEVPKALGDVFESIAGAIFLDSNMSLDVVWHVYSNMMSPEIEQFSNSVPKSPIRELLEL---------EPETAKFGKPEKLADGRRVRVTVDVFCKGTFRGIGRNYRIAKCTAAKCALRQLKKQGLIAK 2247          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DICER_XENTR (Endoribonuclease Dicer OS=Xenopus tropicalis GN=dicer1 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.816e-15
Identity = 48/129 (37.21%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTR-------------EVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPIL-KFS-NLQLNPIRELLEL 343
            LTDLRS LVNN  FA++AV   ++K+    S  L   I+++V + +  +  +             E +E    PK +GD+ ES  GAI +DSG +L TVW +    + P++ KFS N+  +P+RELLE+
Sbjct: 1703 LTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWHVYYPMMQPLIEKFSANVPRSPVRELLEM 1831          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DICER_HUMAN (Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 5.816e-15
Identity = 48/129 (37.21%), Postives = 74/129 (57.36%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTR-------------EVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPIL-KFS-NLQLNPIRELLEL 343
            LTDLRS LVNN  FA++AV   ++K+    S  L   I+++V + +  +  +             E +E    PK +GD+ ES  GAI +DSG +L TVW++    + P++ KFS N+  +P+RELLE+
Sbjct: 1732 LTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEM 1860          
BLAST of FC930830 vs. ExPASy Swiss-Prot
Match: DICER_DANRE (Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.816e-15
Identity = 48/129 (37.21%), Postives = 74/129 (57.36%), Query Frame = 2
Query:    2 LTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTR-------------EVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPIL-KFS-NLQLNPIRELLEL 343
            LTDLRS LVNN  FA++AV   ++K+    S  L   I+++V + +  +  +             E +E    PK +GD+ ES  GAI +DSG +L TVW++    + P++ KFS N+  +P+RELLE+
Sbjct: 1675 LTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEM 1803          
The following BLAST results are available for this feature:
BLAST of FC930830 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
DCL4_ORYSJ1.854e-4546.45Endoribonuclease Dicer homolog 4 OS=Oryza sativa s... [more]
DCL4_ARATH2.356e-2433.63Dicer-like protein 4 OS=Arabidopsis thaliana GN=DC... [more]
DCL3A_ORYSJ6.416e-2233.61Endoribonuclease Dicer homolog 3a OS=Oryza sativa ... [more]
DCL3B_ORYSJ2.980e-1934.08Endoribonuclease Dicer homolog 3b OS=Oryza sativa ... [more]
DICER_ARATH7.341e-1833.33Endoribonuclease Dicer homolog OS=Arabidopsis thal... [more]
DCL1_ORYSJ1.252e-1733.33Endoribonuclease Dicer homolog 1 OS=Oryza sativa s... [more]
DCR1_DROME4.453e-1534.34Endoribonuclease Dcr-1 OS=Drosophila melanogaster ... [more]
DICER_XENTR5.816e-1537.21Endoribonuclease Dicer OS=Xenopus tropicalis GN=di... [more]
DICER_HUMAN5.816e-1537.21Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 P... [more]
DICER_DANRE5.816e-1537.21Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34109E04EF PostHarvP1 Citrus clementina cDNA clone C34109E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930830 ID=FC930830|Name=FC930830|organism=Citrus clementina|type=EST|length=717bp
GTTGACAGATTTGAGGTCAATGTTAGTGAATAATCAAGCCTTTGCCAATG
TTGCAGTTGATCAATCCTTCTACAAATTTCTTATCTTTGATTCCAATGTC
CTATCTGAGACTATAAACAATTATGTGGACTATATGATAACACCTTCATC
AACAAGGGAAGTGAAAGAAGGGCCAAGATGTCCAAAGGTTCTTGGTGACT
TGGTAGAGTCTTCTTTGGGAGCCATCCTGCTTGATTCGGGGTTTAATTTG
AATACTGTGTGGAAAATAATGTTATCCTTTTTGGATCCAATCTTGAAATT
TTCAAACTTGCAGCTTAATCCAATTAGGGAGCTACTGGAACTTTGCAACT
CTTATGACTTGGATTTGCAGTTTCCTAGCTTAAAGAAGGGTGGAAAATTT
TTAGCTGAAGCGAAAGTAGCTGTGAAAGATAAAGATGTTTTTATATCTGC
TTGTGCAACAAACCTGAGCAGAAAAGAAGCTATTAGGATTGCTTCGCAAC
AATTATTCTCGAAGTTGAAGGCTGCAGGCTATGTGCCGAAGACTAAATCA
CTGGAGAGTATTTTGAAGTCCAGCCCCAAGTCGGAAGCCAGACTGATTGG
ATATGATGAAACACCTATAAATGTAGTTGCTGCAGATGACAATGTGTTTG
AAAAGTTGAAGATCAGTGAACCTCAGGCGGTAAATTATACTCTACATGTA
TTCTGATAGTGTGGTGG
back to top