FC930883

Overview
NameFC930883
Unique NameFC930883
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length729
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11029 contig Ccv1_Contig11029:320..1047. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930883 vs. ExPASy Swiss-Prot
Match: LGT_CITUN (Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.049e-39
Identity = 82/215 (38.14%), Postives = 130/215 (60.47%), Query Frame = 3
Query:   54 FFSDGFDLDYNRKSDLDHYMETIEKAGPGNLSKLIKNHYHDKHKKLSCIINNPFVPWVVDVAAELGIPCAMLWIQPCSLFSIYYRFYNKLNPFPTSENPNSSVELPWLQTLHTHDLPSFVLPSNPFGSFSRILNDLFQNLNKQYKWVLANSFFELEKEATESMSQLCPIRXXXXXXXXXXXXQDEKLDVGVERWKPEDRCLEWLNSKSILQLLHI 698
            FF DG+D D  R+ DLD YM  +E  G   + K+IK    ++++ +SC+INNPF+PWV DVA  LG+P AMLW+Q C+ F+ YY +++ L PFP+ + P   V+LP +  L   ++PSF+ PS P+    R +   ++NL K +  +L ++F+ELEKE  + M+++CPI+            +   L V  +  KP D C++WL+ K    +++I
Sbjct:   71 FFEDGWDEDDPRREDLDQYMAQLELIGKQVIPKIIKKSA-EEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDEMPSFLHPSTPYPFLRRAILGQYENLGKPF-CILLDTFYELEKEIIDYMAKICPIK---PVGPLFKNPKAPTLTVRDDCMKP-DECIDWLDKKPPSSVVYI 279          
BLAST of FC930883 vs. ExPASy Swiss-Prot
Match: Y1567_ARATH (Uncharacterized UDP-glucosyltransferase At1g05670 OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.520e-15
Identity = 62/230 (26.96%), Postives = 112/230 (48.70%), Query Frame = 3
Query:   36 DDIPCLFFSDGFDLDYNRKSDLDHYMETIEKAGPGNLSKLIKNHYHDKHKKLS-----CIINNPFVPWVVDVAAELGIPCAMLWIQPCSLFSIYYRFYNKLNPFPTSENPNSSV-ELPWLQTLHTHDLPSFVLPSNPFGSFSRILNDLFQNLNKQYKWVLANSFFELEKEATESMSQLCPIRXXXXXXXXXXXXQ--DEKLDVGVERWKPE-DRCLEWLNSKSILQLLHI 698
            D I  +  S+GF     R  DLD YME +E +    L KLI++       KLS      ++ +  +PW++DVA   G+  A+ + QP  + +IYY  +      P+++  +S++   P L  L+ +DLPSF+  S+ +    R + D   N+++    VL N+F +LE++  + +  + P+             +   E  + G   +  +   C+EWLNSK    ++++
Sbjct:   53 DTITVVPISNGFQEGQERSEDLDEYMERVESSIKNRLPKLIED------MKLSGNPPRALVYDSTMPWLLDVAHSYGLSGAVFFTQPWLVSAIYYHVFKGSFSVPSTKYGHSTLASFPSLPILNANDLPSFLCESSSYPYILRTVIDQLSNIDR-VDIVLCNTFDKLEEKLLKWIKSVWPVLNIGPTVPSMYLDKRLAEDKNYGFSLFGAKIAECMEWLNSKQPSSVVYV 275          
BLAST of FC930883 vs. ExPASy Swiss-Prot
Match: UGAGT_ARATH (Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT75C1 PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.024e-14
Identity = 52/169 (30.77%), Postives = 84/169 (49.70%), Query Frame = 3
Query:   54 FFSDGFDLDYNRKSDLDHYMETIEKAGPGNLSKLIKNHYH--DKHKKLSCIINNPFVPWVVDVAAELGIPCAMLWIQPCSLFSIYYRFYNKLNPFPTSENPNSSVELPWLQTLHTHDLPSFVLPSNPFGSFSRILNDLFQNLNKQYK-WVLANSFFELEKEATESMSQL 551
            +F+DGFD       D   YM  +++ G   L  +IK +     + + ++ +I +  VPWV  VA E  +P  +LWI+P ++  IYY ++N          P   ++LP L  + T DLPSF+ PS    S    L +  + L  +    +L N+F  LE +A  S+ +L
Sbjct:   67 WFTDGFDDGLKSFEDQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVAREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFDVEP---IKLPKLPLITTGDLPSFLQPSKALPSALVTLREHIEALETESNPKILVNTFSALEHDALTSVEKL 232          
BLAST of FC930883 vs. ExPASy Swiss-Prot
Match: IABG2_ARATH (Indole-3-acetate beta-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT75B2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.635e-12
Identity = 53/166 (31.93%), Postives = 77/166 (46.39%), Query Frame = 3
Query:   36 DDIPCLFFSDGFDLDY-NRKSDLDHYMETIEKAGPGNLSKLIKNHYHDKHKKLSCIINNPFVPWVVDVAAELGIPCAMLWIQPCSLFSIYYRFYNKLNPFPTSENPNSSVELPWLQTLHTHDLPSFVLPSNPFGSFSRILNDLFQNLNKQYK-WVLANSFFELEKE 527
            +++  L FSDGFD    +   D+ + +   E+ G   LS  I+ + +     +SC+I      WV  VA    +P   LWIQP   F IYY +         S   NS  E P L +L   DLPSF+ PSN   +   +  +L   L ++    +L N+F  LE E
Sbjct:   56 ENLSFLTFSDGFDDGVISNTDDVQNRLVHFERNGDKALSDFIEANQNGD-SPVSCLIYTILPNWVPKVARRFHLPSVHLWIQPAFAFDIYYNY---------STGNNSVFEFPNLPSLEIRDLPSFLSPSNTNKAAQAVYQELMDFLKEESNPKILVNTFDSLEPE 211          
The following BLAST results are available for this feature:
BLAST of FC930883 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LGT_CITUN2.049e-3938.14Limonoid UDP-glucosyltransferase OS=Citrus unshiu ... [more]
Y1567_ARATH3.520e-1526.96Uncharacterized UDP-glucosyltransferase At1g05670 ... [more]
UGAGT_ARATH1.024e-1430.77Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis... [more]
IABG2_ARATH1.635e-1231.93Indole-3-acetate beta-glucosyltransferase 2 OS=Ara... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110A11EF PostHarvP1 Citrus clementina cDNA clone C34110A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930883 ID=FC930883|Name=FC930883|organism=Citrus clementina|type=EST|length=729bp
GATTCACCAGCAGCAAAATCAATGATTGTGTTTCTGATGATATCCCATGT
CTATTTTTCTCCGATGGGTTCGATTTAGATTACAACCGCAAATCCGATTT
AGATCACTACATGGAAACTATAGAGAAAGCTGGACCTGGTAACCTCTCAA
AACTTATCAAAAATCATTACCATGATAAGCACAAGAAGCTCTCTTGCATC
ATTAACAATCCATTTGTTCCATGGGTTGTTGATGTTGCTGCTGAGCTTGG
AATCCCGTGTGCCATGCTTTGGATTCAACCATGTTCACTTTTTTCTATTT
ACTATCGTTTCTATAACAAATTAAACCCATTTCCCACCTCGGAGAATCCA
AATTCAAGTGTTGAGTTACCATGGTTACAAACTTTGCACACACATGATTT
GCCTTCATTTGTTCTCCCTTCAAATCCATTTGGTAGCTTCTCAAGAATTC
TCAATGACTTGTTCCAAAACCTGAATAAGCAATACAAGTGGGTATTAGCA
AATTCTTTCTTTGAGTTAGAGAAAGAAGCCACTGAGTCTATGTCTCAGCT
TTGTCCAATACGACCTGTCGGTCCTTTAGTCCCACCTTCATTGCTAGGCC
AAGATGAAAAGCTTGATGTTGGAGTTGAAAGGTGGAAGCCTGAAGATCGT
TGCTTAGAATGGCTTAACAGCAAATCAATTCTTCAGTTGTTACATATCAT
TTGGTAGCCTGCTCANTATCAGCTATCAA
back to top