FC930886

Overview
NameFC930886
Unique NameFC930886
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length683
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13706 contig Ccv1_Contig13706:50..732. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_YEAST (Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae GN=GCD11 PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.102e-68
Identity = 134/198 (67.68%), Postives = 157/198 (79.29%), Query Frame = 1
Query:   88 ISFTGLNITSGNTDNKERGIFKETGKMSRKGLMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            ++FTGL       + K +  F+E G     GL EQ L+  D +KL+PLS E+I+RQATINIGTIGHVAHGKSTVV+AISGVQTVRFK+ELERNITIKLGYANAKIYKC++  CP P CY+++ S KE +P C  PG    R KL+RHVSFVDCPGHDILM+TML+GAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   49 VAFTGLEEDGETEEEKRKREFEEGG-----GLPEQPLNP-DFSKLNPLSAEIINRQATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQEPTCPEPDCYRSFKSDKEISPKCQRPGCPG-RYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 239          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_CHICK (Eukaryotic translation initiation factor 2 subunit 3 OS=Gallus gallus GN=EIF2S3 PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.102e-68
Identity = 132/167 (79.04%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDVTKL PLSPEVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  C RP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLATLDVTKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCSRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_RAT (Eukaryotic translation initiation factor 2 subunit 3 OS=Rattus norvegicus GN=Eif2s3 PE=1 SV=2)

HSP 1 Score: 259.225 bits (661), Expect = 1.439e-68
Identity = 132/167 (79.04%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_PONAB (Eukaryotic translation initiation factor 2 subunit 3 OS=Pongo abelii GN=EIF2S3 PE=2 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.439e-68
Identity = 132/167 (79.04%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_MOUSE (Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus GN=Eif2s3x PE=1 SV=2)

HSP 1 Score: 259.225 bits (661), Expect = 1.439e-68
Identity = 132/167 (79.04%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_HUMAN (Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens GN=EIF2S3 PE=1 SV=3)

HSP 1 Score: 259.225 bits (661), Expect = 1.439e-68
Identity = 132/167 (79.04%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2H_MOUSE (Eukaryotic translation initiation factor 2 subunit 3, Y-linked OS=Mus musculus GN=Eif2s3y PE=2 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 3.205e-68
Identity = 130/167 (77.84%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDVTKL PLS E+ISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    +L+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLATLDVTKLTPLSREIISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDSSCPRPECYRSCGSSTPDEFPSDIPGTKG-NFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_BOVIN (Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus GN=EIF2S3 PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.186e-68
Identity = 131/167 (78.44%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDV+KL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLATLDVSKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2G_SCHPO (Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe GN=tif213 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.141e-68
Identity = 124/159 (77.99%), Postives = 139/159 (87.42%), Query Frame = 1
Query:  205 LDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            LD+++L P+ P +ISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYKC ++ CPRP CY++Y S KED+P C++    N  M L+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:    5 LDISELSPIHPAIISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKCSNEECPRPGCYRSYSSNKEDHPPCEIC---NSPMNLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 160          
BLAST of FC930886 vs. ExPASy Swiss-Prot
Match: IF2GL_HUMAN (Eukaryotic translation initiation factor 2 subunit 3-like protein OS=Homo sapiens PE=1 SV=2)

HSP 1 Score: 256.529 bits (654), Expect = 9.326e-68
Identity = 130/167 (77.84%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  181 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPTTSEHLAAVEIM 681
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIY+ +D  CPRP CY++ GS   D    D+PG +    +L+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM
Sbjct:   15 LSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKG-NFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM 180          
The following BLAST results are available for this feature:
BLAST of FC930886 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
IF2G_YEAST1.102e-6867.68Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_CHICK1.102e-6879.04Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_RAT1.439e-6879.04Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_PONAB1.439e-6879.04Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_MOUSE1.439e-6879.04Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_HUMAN1.439e-6879.04Eukaryotic translation initiation factor 2 subunit... [more]
IF2H_MOUSE3.205e-6877.84Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_BOVIN4.186e-6878.44Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_SCHPO7.141e-6877.99Eukaryotic translation initiation factor 2 subunit... [more]
IF2GL_HUMAN9.326e-6877.84Eukaryotic translation initiation factor 2 subunit... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B02EF PostHarvP1 Citrus clementina cDNA clone C34110B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930886 ID=FC930886|Name=FC930886|organism=Citrus clementina|type=EST|length=683bp
CACACCCTCTCCAATCAATATAGCGGTAAACCTCAGTCAAATCTCGGTCT
CGCAGTCGTTCTCCGGTCGCAACTTGCTCTGCATTCAATCAGTTTTACGG
GCTTGAACATTACTAGTGGCAATACAGACAATAAGGAGAGGGGCATTTTC
AAAGAAACAGGCAAGATGTCACGGAAGGGTTTGATGGAACAGGACTTGAG
TAAGTTGGATGTAACTAAGTTGCATCCTCTTTCTCCTGAAGTCATTTCTC
GCCAGGCTACTATTAATATTGGAACTATCGGTCATGTGGCCCATGGCAAA
TCAACTGTTGTGAAGGCAATATCTGGTGTTCAGACTGTTCGTTTTAAGAA
TGAATTAGAGCGTAACATTACTATCAAGCTTGGATATGCAAATGCCAAGA
TATACAAATGTGAAGATGATCGTTGCCCACGACCAATGTGCTATAAGGCA
TATGGAAGTGGGAAAGAAGATAATCCTCTGTGCGATGTGCCTGGTTTTGA
GAACTGCAGGATGAAATTGCTTAGGCATGTCTCTTTTGTTGATTGCCCGG
GTCATGATATTCTTATGGCTACAATGCTTAATGGAGCAGCAATTATGGAT
GGAGCATTGCTTCTCATAGCAGCCAATGAAAGTTGCCCGCAACCCACAAC
ATCGGAGCACTTGGCAGCTGTTGAAATCATGCG
back to top