FC930887

Overview
NameFC930887
Unique NameFC930887
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length683
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9509 contig Ccv1_Contig9509:1..683. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 3.527e-83
Identity = 144/148 (97.30%), Postives = 148/148 (100.00%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 646
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYESTARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 7.858e-83
Identity = 145/148 (97.97%), Postives = 147/148 (99.32%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 646
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPS+SPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+DK KYESTARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.340e-82
Identity = 144/148 (97.30%), Postives = 147/148 (99.32%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 646
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+DK KYESTAR+WTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.751e-82
Identity = 143/148 (96.62%), Postives = 148/148 (100.00%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 646
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPYAGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYE+TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 8.688e-82
Identity = 141/148 (95.27%), Postives = 148/148 (100.00%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 646
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP++SPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYE+TAR+WTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 6.227e-80
Identity = 137/148 (92.57%), Postives = 147/148 (99.32%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 646
            MASKRILKELKDLQKDPP++CSAGPVAEDMFHWQATIMGP +SPYAGGVFLV+IHFPPDYPFKPPKV+F+TKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D++KYESTARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.099e-76
Identity = 131/148 (88.51%), Postives = 142/148 (95.95%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 646
            MASKRI KEL+DLQ+DPP SCSAGP  +DMF WQATIMGP+DSP+AGGVFLVTIHFPPDYPFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALT+SKVLLSICSLLTDPNPDDPLVPEIAH+YK+D+ KYESTA+SWTQKYAMG
Sbjct:    1 MASKRINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAMG 148          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 4.618e-75
Identity = 127/147 (86.39%), Postives = 140/147 (95.24%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAM 643
            MA++RILKELK+LQ+DPP SCSAGP  EDMFHWQATIMGP++SPY+GGVFLV IHFPPDYPFKPPKV FRTKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YK+DK KYE+ ARSWTQKYA+
Sbjct:    1 MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYAL 147          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 1.301e-69
Identity = 119/147 (80.95%), Postives = 135/147 (91.84%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAM 643
            MA KRI KEL DL +DPP+SCSAGPV ED+FHWQATIMGPSDSPYAGGVF + IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPDDPLVPEIAH+YK+ +A+YESTAR WT+KYA+
Sbjct:    1 MALKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPSDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTARAQYESTAREWTRKYAI 147          
BLAST of FC930887 vs. ExPASy Swiss-Prot
Match: UB2D4_HUMAN (Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.786e-69
Identity = 118/147 (80.27%), Postives = 129/147 (87.76%), Query Frame = 2
Query:  203 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAM 643
            MA KRI KEL DLQ+DPP  CSAGPV +D+FHWQATIMGP+DSPY GGVF +TIHFP DYPFKPPKVAF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVPEIAH YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147          
The following BLAST results are available for this feature:
BLAST of FC930887 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC28_ARATH3.527e-8397.30Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UBC10_ARATH7.858e-8397.97Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC9_ARATH1.340e-8297.30SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC4_SOLLC1.751e-8296.62Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC8_ARATH8.688e-8295.27Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC11_ARATH6.227e-8092.57Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC30_ARATH1.099e-7688.51Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC29_ARATH4.618e-7586.39Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBC1_MAGGR1.301e-6980.95Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]
UB2D4_HUMAN3.786e-6980.27Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B03EF PostHarvP1 Citrus clementina cDNA clone C34110B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930887 ID=FC930887|Name=FC930887|organism=Citrus clementina|type=EST|length=683bp
GTTTCTCGACGATATTTGTGTTGAAGGACAACAAAGCAAGGGGTTGATAG
AGGAGCGAGGCGGGGGCGGCTTGACGACCTAGATCTGCTTCACCGTTTCG
CTTTCTCGACGCTATCGCTCTCCGATCCTGTTCTCTGCCGCGCAAGTTTC
GCAGGTCTTAAGGTTCGTTGTAGTTTCAATTTTAATAATCCCTTGAAGAG
TCATGGCTTCAAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGGAT
CCTCCCACGTCTTGCAGCGCTGGCCCTGTGGCTGAAGACATGTTCCACTG
GCAAGCAACAATTATGGGCCCTTCTGATAGCCCATATGCAGGAGGTGTAT
TTTTAGTTACCATTCATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAG
GTTGCTTTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAG
CATCTGTCTTGATATCCTTAAAGAACAGTGGAGTCCAGCGCTTACCATTT
CAAAGGTCCTGCTCTCTATCTGCTCCTTGCTTACTGATCCAAATCCCGAC
GACCCTCTTGTACCGGAGATTGCCCACATGTACAAGTCCGACAAGGCCAA
ATATGAATCCACGGCCAGGAGCTGGACACAGAAGTATGCCATGGGATGAA
GGTTTGTAGGATATTGCAGAAAAGGAGCATTTA
back to top