FC930888

Overview
NameFC930888
Unique NameFC930888
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:23..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 341.273 bits (874), Expect = 3.081e-93
Identity = 177/213 (83.10%), Postives = 188/213 (88.26%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECETHIAIGYQ 687
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REALE+SSQQEYLKLKARYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EA +TLKQRLMEG  +N LQ   +A+D GYG +  Q QGD FFH LECE  + IGYQ
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQ 219          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.386e-85
Identity = 167/222 (75.23%), Postives = 187/222 (84.23%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREA--LELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQLNPSAEDCGYGL-KPAQPQGDTFFHA--LECETHIAIGYQPAXP 699
            LKR+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+SSMLKTLERYQKCNYGAPE NV+++EA  LELSSQQEYLKLKARYE+LQRSQRNL+GE+LGPL+SK+LE+LERQLD SLKQIRSTRTQ+MLD L +LQ KE LL EA + L+QR MEGYQ+N+LQLN SAED GYG        GD  F    +ECE  + IGY    P
Sbjct:    8 LKRVENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSSMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQRSQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRALRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGYHQGDP 228          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 6.439e-83
Identity = 165/218 (75.69%), Postives = 184/218 (84.40%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQLNPSAEDCG-YGLKPAQPQ--GDTFFHALECETHIAIGYQ 687
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSML+TLERYQKCNYGAPEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELESLERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E  KTL+ RL +GYQ+  LQLNP+ E+   YG    Q Q     FF  LECE  + IGYQ
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQ 224          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: AGL9_SOLLC (Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 8.991e-82
Identity = 155/173 (89.60%), Postives = 162/173 (93.64%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVN 567
            LKRIE KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REALE+SSQQEYLKLK RYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+ Q KE  L+EA +TLKQRLMEG Q+N
Sbjct:    8 LKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALEISSQQEYLKLKGRYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQRLMEGSQLN 180          

HSP 2 Score: 22.3274 bits (46), Expect = 8.991e-82
Identity = 11/25 (44.00%), Postives = 14/25 (56.00%), Query Frame = 2
Query:  587 VQKIVVMGLNQLNLRAIPSFTPWNV 661
            + K+  M   QL LRA+ SF  W V
Sbjct:  186 MHKLWAMAGKQLKLRAMASFILWIV 210          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.586e-81
Identity = 162/220 (73.64%), Postives = 184/220 (83.64%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQLNPSAED--CGYGLKPAQPQGDT---FFHALECETHIAIGYQ 687
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSM++TLERYQKCNYG PEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELE LERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E  KTL+ RL +GYQ+  LQLNP+ ED    YG    Q Q ++   FF  LECE  + +GYQ
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKTLRLRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMGYQ 226          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.064e-77
Identity = 154/214 (71.96%), Postives = 173/214 (80.84%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQL-NPS-AEDCGYGLKPAQPQGDTFFHALECETHIAIGY 684
            LK IENKINRQVTFAKRR  LLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS+SMLKTLE+YQKCN+G+PE  + +RE    SSQQEYLKLK R EALQRSQRNLLGE+LGPL SKELE LERQLD SL+QIRSTRTQ+MLD L +LQ +EQ+L EA KTLK+R  E  Q N  Q+ +PS     GYG +PAQ  G+ F+H LECE  + IGY
Sbjct:    8 LKMIENKINRQVTFAKRRKRLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRET--QSSQQEYLKLKNRVEALQRSQRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRFEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEPTLQIGY 219          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: SEP1_ARATH (Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 6.469e-67
Identity = 139/218 (63.76%), Postives = 163/218 (74.77%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQLNPSA------EDCGYGLKPAQPQGDTFFHALECETHIAIGY 684
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS+MLKTL+RYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+RS +TQYMLD L++LQ+KEQ+L E  + L  +L +   V +  +          ++  Y    AQ QG   +  LEC   + +GY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQG--LYQPLECNPTLQMGY 222          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: SEP2_ARATH (Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.211e-66
Identity = 137/217 (63.13%), Postives = 162/217 (74.65%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQLNPSAE-----DCGYGLKPAQPQGDTFFHALECETHIAIGY 684
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LI+FSNRGKLYEFCS+S+MLKTLERYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+R  +TQYMLD L++LQ KE +L +A + L  +L +   V    +    E     +  YG   A  QG   + +LEC+  + IGY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQG--LYQSLECDPTLQIGY 221          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 248.44 bits (633), Expect = 2.718e-65
Identity = 138/220 (62.73%), Postives = 165/220 (75.00%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--ETHIAIGY 684
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEA + L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   E  + IGY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY 227          
BLAST of FC930888 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 248.44 bits (633), Expect = 2.718e-65
Identity = 138/220 (62.73%), Postives = 165/220 (75.00%), Query Frame = 1
Query:   49 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEAXKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--ETHIAIGY 684
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEA + L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   E  + IGY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY 227          
The following BLAST results are available for this feature:
BLAST of FC930888 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AGL9_PETHY3.081e-9383.10Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
MTF1_PEA1.386e-8575.23MADS-box transcription factor 1 OS=Pisum sativum G... [more]
SEP3_ARATH6.439e-8375.69Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SOLLC8.991e-8289.60Agamous-like MADS-box protein AGL9 homolog OS=Sola... [more]
AGL9_SINAL1.586e-8173.64Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_ARADE1.064e-7771.96Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
SEP1_ARATH6.469e-6763.76Developmental protein SEPALLATA 1 OS=Arabidopsis t... [more]
SEP2_ARATH3.211e-6663.13Developmental protein SEPALLATA 2 OS=Arabidopsis t... [more]
MADS7_ORYSJ2.718e-6562.73MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS7_ORYSI2.718e-6562.73MADS-box transcription factor 7 OS=Oryza sativa su... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B04EF PostHarvP1 Citrus clementina cDNA clone C34110B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930888 ID=FC930888|Name=FC930888|organism=Citrus clementina|type=EST|length=707bp
GGAGAAGAAGAAAGAAAGGAGAAGAAAATGGGAAGGGGTAGGGTTGAGTT
GAAGAGGATAGAGAACAAGATCAACAGGCAAGTGACCTTTGCAAAGAGAA
GAAATGGCCTATTGAAGAAAGCTTATGAGCTTTCCGTTCTTTGTGATGCT
GAGGTTGCTCTCATCATTTTCTCCAATAGAGGAAAGCTGTACGAGTTTTG
CAGTAGTTCAAGCATGCTCAAAACGCTTGAGAGGTACCAGAAGTGCAACT
ATGGAGCACCAGAACCGAATGTGTCCGCAAGGGAGGCCCTGGAGCTAAGT
AGCCAGCAAGAATATCTGAAGCTTAAAGCACGATATGAAGCCCTACAGAG
ATCCCAAAGGAATCTCCTTGGAGAAGAACTTGGCCCTCTAAACAGCAAAG
AGCTTGAGTCACTTGAAAGGCAGCTTGATATGTCATTGAAGCAGATCAGA
TCAACAAGAACTCAGTACATGCTGGATACCCTTACTGAACTGCAACATAA
GGAACAGTTGCTGAGCGAAGCANATAAGACCCTCAAACAAAGGTTGATGG
AGGGATACCAAGTGAACACACTTCAATTGAATCCTAGTGCAGAAGATTGT
GGTTATGGGCTTAAACCAGCTCAACCTCAGGGCGATACCTTCTTTCACGC
CTTGGAATGTGAAACCCACATTGCAATTGGATACCAGCCTGCGNACCCCA
TATCGGT
back to top