FC930890

Overview
NameFC930890
Unique NameFC930890
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length398
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig752 contig Ccv1_Contig752:1..398. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 221.09 bits (562), Expect = 1.376e-57
Identity = 108/118 (91.53%), Postives = 114/118 (96.61%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK+EDEEHKKKVEAKNALENYAYNMRNT++DEKIG KL  ADKKKIED+I+QAIQWL+ NQLAEADEFEDKMKELESICNPIIAKMY
Sbjct:  500 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY 617          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.782e-56
Identity = 107/118 (90.68%), Postives = 111/118 (94.07%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKAEDEE KKKVEAKN+LENYAYNMRNTVKDEKIGSKL   DKKKIEDA+DQAI WL+SNQLAE DEFEDKMKELE ICNPIIAKMY
Sbjct:  502 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMY 619          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.552e-56
Identity = 105/118 (88.98%), Postives = 112/118 (94.92%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL   D+ KIEDAI+QAIQWLD NQLAEA+EFEDKMKELES+CNPIIAKMY
Sbjct:  500 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEEFEDKMKELESLCNPIIAKMY 617          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 7.552e-56
Identity = 102/118 (86.44%), Postives = 113/118 (95.76%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTG+KNKITITNDKGRLSK++IEKMVQEAEKYK+EDEEHKKKVEAKNALENYAYNMRNT++DEKIG KL  ADKKK+ED+I++AIQWLD NQL EADEFEDKMKELES+CNPIIAKMY
Sbjct:  500 TTGKKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPIIAKMY 617          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 214.542 bits (545), Expect = 1.288e-55
Identity = 105/118 (88.98%), Postives = 112/118 (94.92%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTGQKNKI ITNDKGRLSK+EIEKMVQEAEKYK+EDEEHKKKVE+KNALENYAYNMRN VKDEKIG+KL  ADKKKIE+AID +IQWLD NQLAEADEF+DKMKELESICNPIIAKMY
Sbjct:  500 TTGQKNKIRITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNIVKDEKIGAKLSEADKKKIEEAIDASIQWLDGNQLAEADEFDDKMKELESICNPIIAKMY 617          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.870e-55
Identity = 104/118 (88.14%), Postives = 114/118 (96.61%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK+EDEE KKKVEAKNALENYAYNMRNT+KD+KI S+L  ADKK+IEDAID+AI+WLD+NQLAEADEFEDKMKELESICNPIIAKMY
Sbjct:  500 TTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADEFEDKMKELESICNPIIAKMY 617          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 4.895e-55
Identity = 103/118 (87.29%), Postives = 112/118 (94.92%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK+EDEEHKKKV+AKNALENYAYNMRNT++DEKIG KL   DKKKIED+I+ AI+WL++NQLAE DEFEDKMKELESICNPIIAKMY
Sbjct:  500 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMKELESICNPIIAKMY 617          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 5.412e-54
Identity = 103/118 (87.29%), Postives = 109/118 (92.37%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            TTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKAEDEE KKKV+AKNALENYAYNMRNT+KD+KI SKL   DKKKIEDA+D AI WLDSNQLAE +EFEDKMKELE ICNPIIAKMY
Sbjct:  496 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEVKKKVDAKNALENYAYNMRNTIKDDKIASKLPAEDKKKIEDAVDGAISWLDSNQLAEVEEFEDKMKELEGICNPIIAKMY 613          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.780e-50
Identity = 94/118 (79.66%), Postives = 106/118 (89.83%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            T G KNKITITNDKGRLSK+EIEKMV++AE+YKAEDEE KKKVEAKN+LENYAYNMRNT+KDEKIG KL P +K+KIE A++ AIQWL+ NQ+AE DEFEDK KELE ICNPIIAKMY
Sbjct:  499 TAGVKNKITITNDKGRLSKEEIEKMVKDAERYKAEDEEVKKKVEAKNSLENYAYNMRNTIKDEKIGGKLSPDEKQKIEKAVEDAIQWLEGNQMAEVDEFEDKQKELEGICNPIIAKMY 616          
BLAST of FC930890 vs. ExPASy Swiss-Prot
Match: HSP70_DAUCA (Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.168e-48
Identity = 91/118 (77.12%), Postives = 105/118 (88.98%), Query Frame = 2
Query:    2 TTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY 355
            T G KNKITITND GRLSKDEIEK+V+EAEKYKAEDEE KKKVEAKNALENYAYNMRNT+KD+KI  KLD  DK+KIE A+++AI+WL+ NQLAE DE EDK+KELE +CNPIIA++Y
Sbjct:  502 TAGVKNKITITNDNGRLSKDEIEKLVKEAEKYKAEDEEVKKKVEAKNALENYAYNMRNTIKDDKIPGKLDAGDKEKIETAVNEAIEWLEKNQLAEVDELEDKLKELEGLCNPIIARLY 619          
The following BLAST results are available for this feature:
BLAST of FC930890 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 218
Match NameE-valueIdentityDescription
HSP71_ARATH1.376e-5791.53Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP71_SOLLC5.782e-5690.68Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP72_SOLLC7.552e-5688.98Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP72_ARATH7.552e-5686.44Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP7E_SPIOL1.288e-5588.98Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP7C_PETHY2.870e-5588.14Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP73_ARATH4.895e-5587.29Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP70_MAIZE5.412e-5487.29Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP70_SOYBN2.780e-5079.66Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP70_DAUCA1.168e-4877.12Heat shock 70 kDa protein OS=Daucus carota GN=HSP7... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B06EF PostHarvP1 Citrus clementina cDNA clone C34110B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930890 ID=FC930890|Name=FC930890|organism=Citrus clementina|type=EST|length=398bp
GACAACGGGCCAAAAGAACAAGATCACAATCACCAACGATAAGGGTAGAT
TGTCAAAGGATGAAATTGAGAAGATGGTTCAAGAGGCCGAGAAGTACAAG
GCTGAAGACGAGGAGCACAAGAAGAAGGTCGAGGCCAAGAATGCCTTGGA
AAACTATGCCTACAATATGAGGAACACTGTCAAGGACGAGAAGATCGGCT
CCAAACTTGATCCAGCTGACAAGAAGAAGATTGAGGATGCCATTGATCAG
GCAATTCAATGGCTTGATAGCAACCAGCTGGCTGAGGCCGATGAATTTGA
AGACAAGATGAAGGAGCTTGAGAGCATCTGCAATCCCATCATTGCCAAGA
TGTATNCAGGTGCTGGTGGTGATATGGGCGGTGGCATGGATGATGATG
back to top