FC930892

Overview
NameFC930892
Unique NameFC930892
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length740
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT1_ARATH (Adenine phosphoribosyltransferase 1 OS=Arabidopsis thaliana GN=APT1 PE=2 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 1.162e-29
Identity = 63/86 (73.26%), Postives = 75/86 (87.21%), Query Frame = 2
Query:  176 VRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLL 433
            +  + G++ARGFIFGPPIA AIGA FVPMRKPKKLPG++ISEEYSLEYG   +EMHV AV+ GERA+I+DDL+A GGTL+AAIRLL
Sbjct:  120 ISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDTIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLL 205          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT1_WHEAT (Adenine phosphoribosyltransferase 1 OS=Triticum aestivum GN=APT1 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.165e-27
Identity = 60/86 (69.77%), Postives = 71/86 (82.56%), Query Frame = 2
Query:  176 VRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLL 433
            +  + G++ARGFIFGPPIA AIGA FVP+RKPKKLPGE+ISEEYSLEYG   +EMHV AVQ  +R LIVDDL+A GGTL AA +L+
Sbjct:   56 ITVVAGVEARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPNDRVLIVDDLIATGGTLCAAAKLI 141          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT2_ARATH (Adenine phosphoribosyltransferase 2 OS=Arabidopsis thaliana GN=APT2 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.680e-26
Identity = 59/87 (67.82%), Postives = 72/87 (82.76%), Query Frame = 2
Query:  173 SVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLL 433
            ++  + G++ARGFIFGPPIA AIGA FVP+RKP KLPG +ISEEY LEYG+  +EM V AV++ ERALI+DDLVA GGTLSA+I LL
Sbjct:   62 NISLVAGVEARGFIFGPPIALAIGAKFVPLRKPGKLPGRVISEEYELEYGRDCLEMSVEAVKSEERALIIDDLVATGGTLSASINLL 148          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT_YERPY (Adenine phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=apt PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 50/117 (42.74%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  122 FSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLLGSMQNHIFILIYI 472
            +S S+    + +SE    V  + G +ARGF+FG P+A A+G  FVP+RKP KLP E ISE Y LEYG   +E+H  ++Q G++ L+VDDL+A GGT+ A ++L+  +   +    +I
Sbjct:   45 YSASIELLSEHYSESG--VTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFI 159          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT_YERPS (Adenine phosphoribosyltransferase OS=Yersinia pseudotuberculosis GN=apt PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 50/117 (42.74%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  122 FSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLLGSMQNHIFILIYI 472
            +S S+    + +SE    V  + G +ARGF+FG P+A A+G  FVP+RKP KLP E ISE Y LEYG   +E+H  ++Q G++ L+VDDL+A GGT+ A ++L+  +   +    +I
Sbjct:   45 YSASIELLSEHYSESG--VTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFI 159          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT_YERPP (Adenine phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=apt PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 50/117 (42.74%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  122 FSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLLGSMQNHIFILIYI 472
            +S S+    + +SE    V  + G +ARGF+FG P+A A+G  FVP+RKP KLP E ISE Y LEYG   +E+H  ++Q G++ L+VDDL+A GGT+ A ++L+  +   +    +I
Sbjct:   45 YSASIKLLSEHYSESG--VTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFI 159          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT_YERPN (Adenine phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=apt PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 50/117 (42.74%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  122 FSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLLGSMQNHIFILIYI 472
            +S S+    + +SE    V  + G +ARGF+FG P+A A+G  FVP+RKP KLP E ISE Y LEYG   +E+H  ++Q G++ L+VDDL+A GGT+ A ++L+  +   +    +I
Sbjct:   45 YSASIKLLSEHYSESG--VTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFI 159          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT_YERPG (Adenine phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=apt PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 50/117 (42.74%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  122 FSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLLGSMQNHIFILIYI 472
            +S S+    + +SE    V  + G +ARGF+FG P+A A+G  FVP+RKP KLP E ISE Y LEYG   +E+H  ++Q G++ L+VDDL+A GGT+ A ++L+  +   +    +I
Sbjct:   45 YSASIKLLSEHYSESG--VTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFI 159          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT_YERPE (Adenine phosphoribosyltransferase OS=Yersinia pestis GN=apt PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 50/117 (42.74%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  122 FSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLLGSMQNHIFILIYI 472
            +S S+    + +SE    V  + G +ARGF+FG P+A A+G  FVP+RKP KLP E ISE Y LEYG   +E+H  ++Q G++ L+VDDL+A GGT+ A ++L+  +   +    +I
Sbjct:   45 YSASIKLLSEHYSESG--VTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFI 159          
BLAST of FC930892 vs. ExPASy Swiss-Prot
Match: APT_YERPB (Adenine phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=apt PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 50/117 (42.74%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  122 FSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGA*FVPMRKPKKLPGEIISEEYSLEYGKYVMEMHVCAVQAGERALIVDDLVAIGGTLSAAIRLLGSMQNHIFILIYI 472
            +S S+    + +SE    V  + G +ARGF+FG P+A A+G  FVP+RKP KLP E ISE Y LEYG   +E+H  ++Q G++ L+VDDL+A GGT+ A ++L+  +   +    +I
Sbjct:   45 YSASIELLSEHYSESG--VTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFI 159          
The following BLAST results are available for this feature:
BLAST of FC930892 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
APT1_ARATH1.162e-2973.26Adenine phosphoribosyltransferase 1 OS=Arabidopsis... [more]
APT1_WHEAT3.165e-2769.77Adenine phosphoribosyltransferase 1 OS=Triticum ae... [more]
APT2_ARATH2.680e-2667.82Adenine phosphoribosyltransferase 2 OS=Arabidopsis... [more]
APT_YERPY5.782e-2142.74Adenine phosphoribosyltransferase OS=Yersinia pseu... [more]
APT_YERPS5.782e-2142.74Adenine phosphoribosyltransferase OS=Yersinia pseu... [more]
APT_YERPP5.782e-2142.74Adenine phosphoribosyltransferase OS=Yersinia pest... [more]
APT_YERPN5.782e-2142.74Adenine phosphoribosyltransferase OS=Yersinia pest... [more]
APT_YERPG5.782e-2142.74Adenine phosphoribosyltransferase OS=Yersinia pest... [more]
APT_YERPE5.782e-2142.74Adenine phosphoribosyltransferase OS=Yersinia pest... [more]
APT_YERPB5.782e-2142.74Adenine phosphoribosyltransferase OS=Yersinia pseu... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B08EF PostHarvP1 Citrus clementina cDNA clone C34110B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930892 ID=FC930892|Name=FC930892|organism=Citrus clementina|type=EST|length=740bp
GACCAAACATTTTTCCTCACTCTCTCATAATAGAAACCCTAGAATAAAAA
TCGATCAGAAAAGCCACCATTCTGCCACCGTCCAAACCATCATTCTCAAT
TGGACACCCATTTCGCATCGTTTTTCAGTCTCTTTGTCCTTTCGCCACAA
GTTGTTCAGCGAACCCTCACCTTCGGTTCGATTCTTGCAAGGTATTAAAG
CTAGGGGTTTTATATTTGGGCCTCCTATTGCATGGGCTATTGGGGCATAG
TTTGTTCCTATGAGGAAACCTAAGAAGCTTCCTGGGGAGATTATTTCCGA
AGAGTATTCCTTGGAATATGGAAAATATGTAATGGAGATGCATGTATGTG
CTGTACAAGCAGGGGAGCGTGCTTTAATAGTAGACGATCTAGTTGCAATT
GGTGGGACCTTGTCTGCTGCAATCAGGCTACTTGGTAGTATGCAAAACCA
TATATTTATATTGATATACATACAAATGCTGAATGCTTGCTTTTCTTCAT
ACATTCTTCTTTTTTCATACAGCTGCTGTTTTTGCTGTCGAAATGTGCAA
AGATAGCTGCTGTTGTTCTGTTCAAAAGTGCAGAAACAACAGTTGTTTCT
GCTGTTTTGAACAGGAAAAACAGTAGCTGTGTCTGAAATGCACTGATGAT
TCGTGTCTGAATTAATTTTGTTCCCATGAATCTTGCAGTCGCTTTGTAGT
TTTAATTTCATTAAGCGCTGTCAGAGATGTATTGTACTGG
back to top