FC930893

Overview
NameFC930893
Unique NameFC930893
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length634
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930893 vs. ExPASy Swiss-Prot
Match: Y1222_ARATH (Uncharacterized protein At1g32220, chloroplastic OS=Arabidopsis thaliana GN=At1g32220 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.224e-39
Identity = 79/179 (44.13%), Postives = 114/179 (63.69%), Query Frame = 2
Query:  101 SEKLLVLGGNGFVGSHICREALDRGLTVAXXXXXXXXXXXXXWANNVIWHQGNLLSSDSWKEALDGVTAVISCVGGFGSNSYMYKINGTANINAIRAASEKGVKRFVYISAADFGVANYLLQ-GYYEGKRAAETELLTRYPYGGVILRPGFIYGTRTVGGMKLPLGVIGSPMEMVLQHA 634
            SE+++VLGGNGFVGS IC+ A+  G+ V              W + V W  G++   + W E L G TAV+S +GGFG+   M +ING AN+ A+ AA + GV +FV I+  D+ +  ++L  GY+ GKR AE ELL++YP  GV+LRPGFIYG R V G+++PL ++G P++ +   A
Sbjct:   62 SERVVVLGGNGFVGSAICKAAISNGIEVVSVSRSGRPNFEDSWLDQVTWVTGDVFYLN-WDEVLLGATAVVSTIGGFGNEEQMKRINGEANVTAVNAAKDFGVPKFVLITVHDYNLPPFILSNGYFTGKRNAEAELLSKYPTSGVVLRPGFIYGKRKVNGIEVPLDLVGEPLDKIYDSA 239          
The following BLAST results are available for this feature:
BLAST of FC930893 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1222_ARATH1.224e-3944.13Uncharacterized protein At1g32220, chloroplastic O... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B09EF PostHarvP1 Citrus clementina cDNA clone C34110B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930893 ID=FC930893|Name=FC930893|organism=Citrus clementina|type=EST|length=634bp
AGCGTCGGGGAACGGGAGATATCTGTCAACAGATTCTAATAAGGTTGATG
AACCCTTAAAAGTTGAGGAAGCAGAGACAGTAAATGTGCCCCCGCCTCCA
AGTGAAAAGTTGCTTGTTTTAGGTGGAAATGGATTTGTTGGATCGCACAT
TTGCAGAGAAGCTCTCGACCGTGGTTTGACTGTTGCCAGCCTTAGCAGGT
CCGGTCGGTCATCTTTACGTGATTCTTGGGCAAATAATGTGATTTGGCAT
CAAGGAAATCTTCTTTCATCTGATTCATGGAAGGAAGCTTTGGATGGGGT
GACAGCTGTTATCTCCTGTGTTGGAGGTTTTGGGTCCAACTCTTACATGT
ATAAGATTAATGGGACTGCAAACATCAATGCAATCAGAGCTGCTTCAGAA
AAAGGTGTGAAAAGATTTGTTTATATCTCTGCTGCTGACTTTGGTGTGGC
AAATTACTTACTGCAAGGATATTACGAGGGAAAGAGAGCTGCTGAGACAG
AGTTACTGACCAGATACCCTTATGGAGGAGTGATTTTAAGGCCGGGGTTT
ATATATGGAACTCGAACTGTTGGGGGCATGAAGCTACCTCTTGGCGTGAT
TGGTTCTCCAATGGAGATGGTTCTCCAACATGCA
back to top