FC930894

Overview
NameFC930894
Unique NameFC930894
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length649
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10305 contig Ccv1_Contig10305:54..702. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1A_ARATH (GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.965e-72
Identity = 136/174 (78.16%), Postives = 142/174 (81.61%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            MF++DWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESKK            +VPFL+LGNKIDIPYAASE+ELRYHLGLSNFTTGKGKVNL DSNVRPLEVFMCS
Sbjct:    1 MFMIDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDESLASVPFLILGNKIDIPYAASEDELRYHLGLSNFTTGKGKVNLTDSNVRPLEVFMCS 174          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1A_BRACM (GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 8.256e-71
Identity = 134/174 (77.01%), Postives = 140/174 (80.46%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            MF++DWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESKK             VPFL+LGNKIDIPYAASE+ELRYHLGLSNFTTGKGKV+L  SNVRPLEVFMCS
Sbjct:    1 MFVIDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDESLATVPFLILGNKIDIPYAASEDELRYHLGLSNFTTGKGKVDLVGSNVRPLEVFMCS 174          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1B_ARATH (GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.097e-70
Identity = 132/174 (75.86%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            MFL DWFYG+LASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESK+             VPFL+LGNKIDIPYAASE+ELRYHLGL+NFTTGKGKV L DS VRPLEVFMCS
Sbjct:    1 MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCS 174          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR2_SOLLC (GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.248e-68
Identity = 128/174 (73.56%), Postives = 137/174 (78.74%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            MFL+DWFYGVLASLGLWQK+AKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIG IKFKAFDLGGHQIARRVW                   ERF E+KK            NVPFL+LGNKIDIPYAASE+ELRYHLGL+  TTGKG +NLA +NVRP+EVFMCS
Sbjct:    1 MFLVDWFYGVLASLGLWQKDAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGNIKFKAFDLGGHQIARRVWRDYYAKVDAVVYLVDANDRERFPEAKKELDGLLSDESLTNVPFLILGNKIDIPYAASEDELRYHLGLTGVTTGKGNINLAGTNVRPIEVFMCS 174          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1B_BRACM (GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.116e-67
Identity = 131/176 (74.43%), Postives = 137/176 (77.84%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLA--DSNVRPLEVFMCS 648
            MFL DWFYG+LASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERF+ESKK             VPFL+LGNKID PYAASE+ELRYHLGL+NFTTGKGKV  A  DS VRPLEVFMCS
Sbjct:    1 MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFSESKKELDALLSDDALATVPFLILGNKIDNPYAASEDELRYHLGLTNFTTGKGKVTTAGGDSGVRPLEVFMCS 176          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1_TOBAC (GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.198e-53
Identity = 114/179 (63.69%), Postives = 125/179 (69.83%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGN---KIDIPYAASEE-ELRYHLGLSNFT-TGKGKVNLADSNVRPLEVFMCS 648
            MFL+DWFYG+LA+LGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESKK               FL L N   +I+ P     +   RYH+G +  +   +GKVNLADSNVRP+EVFMCS
Sbjct:    1 MFLVDWFYGILATLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDSFDKERFAESKKELDALLSGWSSLAHCFLFLDNWVTRIEHPICCLRKMNWRYHMGANGASPLARGKVNLADSNVRPVEVFMCS 179          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1_USTMA (Small COPII coat GTPase SAR1 OS=Ustilago maydis GN=SAR1 PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.126e-46
Identity = 97/174 (55.75%), Postives = 118/174 (67.82%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            MF+++WF+ +LA LGL  K AKILFLGLDNAGKTTLLHMLK++RL   QPT +PTSEEL+IG++KF  +DLGGHQ ARR+W                   ERFAE++             +VPFL+LGNKID P A SEEELR  +GL   TTGKGKV L D  +RP+E+FMCS
Sbjct:    1 MFIINWFWDILAQLGLAHKNAKILFLGLDNAGKTTLLHMLKNDRLATLQPTLHPTSEELAIGQVKFTTYDLGGHQQARRLWKDYFPEVDGIVFLVDTQDHERFAEARAELDALLSIEELSSVPFLILGNKIDAPGAVSEEELRQAIGLYQ-TTGKGKVPLKD--IRPIEIFMCS 171          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1_YARLI (Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica GN=SAR1 PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.389e-46
Identity = 98/174 (56.32%), Postives = 115/174 (66.09%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            M++++WFY VL+SLGLW K AK+LFLGLDNAGKTTLLHMLK++R+    PT +PTSEELSIG  KF  FDLGGH  ARRVW                    RFAESK              VPFL+LGNKID+P A SE EL+  LGL   TTGKGKV L + N+RP+E+FMCS
Sbjct:    1 MWIVNWFYDVLSSLGLWNKNAKLLFLGLDNAGKTTLLHMLKNDRMAVSNPTVHPTSEELSIGNCKFTTFDLGGHIQARRVWKDYFPEVNGIVFLVDAADPTRFAESKAELDSLLAIEQLKTVPFLILGNKIDMPQAVSELELKDALGLYQ-TTGKGKVPL-EGNIRPIEIFMCS 172          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1_CRYNE (Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans GN=SAR1 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.568e-45
Identity = 98/174 (56.32%), Postives = 116/174 (66.67%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            MF+++WF+ VLASLGL  K AK+LFLGLDNAGKTTLLHMLK++RL   QPT +PTSEEL+IG +KF  +DLGGH  ARR+W                   ERFAESK              VPFL+LGNKID   A SEE+LR+ LGL   TTGKGK+ L D  +RP+EVFMCS
Sbjct:    1 MFIINWFWDVLASLGLMNKSAKLLFLGLDNAGKTTLLHMLKNDRLATLQPTLHPTSEELAIGNVKFTTYDLGGHIQARRLWRDYFPEVDGIVFLVDSADAERFAESKAELDSLLSIESLAQVPFLILGNKIDAYGAVSEEQLRHELGLYQ-TTGKGKIPLRD--IRPIEVFMCS 171          
BLAST of FC930894 vs. ExPASy Swiss-Prot
Match: SAR1_NEOFI (Small COPII coat GTPase sar1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sar1 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.674e-45
Identity = 98/174 (56.32%), Postives = 115/174 (66.09%), Query Frame = 1
Query:  127 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCS 648
            M++++WFY VLASLGL  K AK+LFLGLDNAGKTTLLHMLK++R+   QPT +PTSEEL+IG  +F  FDLGGHQ ARR+W                   ERF ESK              VPFL+LGNKID P A SE+ELR+ LGL   TTGKGKV L    +RP+EVFMCS
Sbjct:    1 MWIINWFYDVLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRVATLQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFPESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHQLGLYQ-TTGKGKVPL--EGIRPIEVFMCS 171          
The following BLAST results are available for this feature:
BLAST of FC930894 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
SAR1A_ARATH1.965e-7278.16GTP-binding protein SAR1A OS=Arabidopsis thaliana ... [more]
SAR1A_BRACM8.256e-7177.01GTP-binding protein SAR1A OS=Brassica campestris G... [more]
SAR1B_ARATH4.097e-7075.86GTP-binding protein SAR1B OS=Arabidopsis thaliana ... [more]
SAR2_SOLLC2.248e-6873.56GTP-binding protein SAR2 OS=Solanum lycopersicum G... [more]
SAR1B_BRACM1.116e-6774.43GTP-binding protein SAR1B OS=Brassica campestris G... [more]
SAR1_TOBAC1.198e-5363.69GTP-binding protein SAR1 OS=Nicotiana tabacum GN=S... [more]
SAR1_USTMA4.126e-4655.75Small COPII coat GTPase SAR1 OS=Ustilago maydis GN... [more]
SAR1_YARLI5.389e-4656.32Small COPII coat GTPase SAR1 OS=Yarrowia lipolytic... [more]
SAR1_CRYNE1.568e-4556.32Small COPII coat GTPase SAR1 OS=Cryptococcus neofo... [more]
SAR1_NEOFI2.674e-4556.32Small COPII coat GTPase sar1 OS=Neosartorya fische... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B10EF PostHarvP1 Citrus clementina cDNA clone C34110B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930894 ID=FC930894|Name=FC930894|organism=Citrus clementina|type=EST|length=649bp
TCTTAGGGTCAGTATCAAATCGAAACAGAGGCCTTGAATTGGACGATCTG
ATTCGTTCTCAGCCTTAGATCGTCGTAAATTCAAGCTCGATCCGTTTTCG
TTTCTAATTTGTCTACCGATAAAGCCATGTTTCTCCTCGACTGGTTCTAC
GGCGTGCTGGCCTCCCTCGGTCTTTGGCAGAAAGAGGCCAAGATCTTGTT
TTTAGGGCTTGATAATGCTGGAAAAACAACGTTGCTTCACATGTTGAAAG
ATGAGAGATTGGTCCAACATCAGCCAACACAGTATCCCACATCGGAAGAG
CTTAGTATTGGGAAAATTAAGTTCAAGGCGTTTGATTTGGGAGGCCATCA
GATTGCTAGGAGAGTCTGGAAGGATTACTATGCGAAGGTTGATGCTGTGG
TATACCTAGTGGATGCCTATGACAAAGAGAGGTTTGCAGAATCAAAGAAA
GAACTGGATGCACTCCTTTCTGATGAGGCATTGGCCAATGTTCCTTTTCT
CGTGTTAGGAAACAAGATTGACATCCCTTATGCTGCTTCTGAGGAAGAGT
TGCGTTACCACCTTGGCCTATCAAATTTCACCACTGGGAAGGGGAAGGTT
AATCTAGCGGACTCAAATGTCCGTCCACTGGAGGTGTTTATGTGTAGCA
back to top