FC930896

Overview
NameFC930896
Unique NameFC930896
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length671
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10240 contig Ccv1_Contig10240:1..671. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROF_TOBAC (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Nicotiana tabacum GN=DHAPS-1 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.208e-57
Identity = 122/204 (59.80%), Postives = 140/204 (68.63%), Query Frame = 2
Query:  113 MALVGST---SITPTKSSFVQPQS---QPF--------ITKPRSNIHPISAVHAADSAKPPSAVKTTTKAPEPVLKT-----SNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSD 667
            MAL  S+   S+ P KS  VQ QS    P          TKP   + PISA+H++DS+K P      +  P P   T     + V   +WTV+SWKSKKALQLPEYPN+EEL+SVLKT+++FPPIVFAG             MG+AFLLQGGDCAESFKEFNANNIRDTFRILLQMG VLMFGGQMPV+KVGRMAGQFAKPRSD
Sbjct:    1 MALSSSSTTNSLLPNKSQLVQNQSLLPSPLKNVSFTTNSTKPVRFVQPISAIHSSDSSKNPIVSDKPSSKPSPPAATVTAAATTVTKTEWTVESWKSKKALQLPEYPNQEELQSVLKTIEEFPPIVFAGEARSLEERLGEAAMGRAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVIKVGRMAGQFAKPRSD 204          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROF_SOLTU (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Solanum tuberosum GN=SHKA PE=1 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 1.348e-55
Identity = 119/188 (63.30%), Postives = 132/188 (70.21%), Query Frame = 2
Query:  140 TPTKSSFVQPQSQPFITKPRSNIHPISAVHAADSAK------------PPSAVKTTTKAPEPVLKTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSD 667
            +P K++F    S    TK    + PISAVH++DS K            PP+A  TT  AP  V KT      +W VDSWKSKKALQLPEYPN+EEL SVLKT+D+FPPIVFAG             MG+AFLLQGGDCAESFKEFNANNIRDTFRILLQMG VLMFGGQMPV+KVGRMAGQFAKPRSD
Sbjct:   27 SPLKNAFFSNNS----TKTVRFVQPISAVHSSDSNKIPIVSDKPSKSSPPAATATTAPAPA-VTKT------EWAVDSWKSKKALQLPEYPNQEELRSVLKTIDEFPPIVFAGEARSLEERLGEAAMGRAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVIKVGRMAGQFAKPRSD 203          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROG_SOLLC (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.760e-55
Identity = 121/210 (57.62%), Postives = 139/210 (66.19%), Query Frame = 2
Query:  113 MALVGSTSITPTKSSFVQPQSQPFITKPRSN-------------IHPISAVHAADSAK------------PPSAVKTTTKAPEPVLKTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSD 667
            MAL  +T+     S+    Q+QP ++ P  N             + PI+AVH++DS K            PP+A  TT  AP  V KT      +W VDSWKSKKALQLPEYP++EEL SVLKT+D+FPPIVFAG             MG+AFLLQGGDCAESFKEFNANNIRDTFRILLQMG VLMFGGQMPV+KVGRMAGQFAKPRSD
Sbjct:    1 MALSTNTTTNSLLSNKSLLQNQPLLSSPSKNAFFSNKSTKTVRFVQPIAAVHSSDSNKNPIVSDKPTKSSPPAATATTAPAPA-VTKT------EWAVDSWKSKKALQLPEYPDQEELRSVLKTIDEFPPIVFAGEARSLEERLGEAAMGRAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVIKVGRMAGQFAKPRSD 203          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROG_ORYSJ (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=DAHPS2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.379e-52
Identity = 107/156 (68.59%), Postives = 119/156 (76.28%), Query Frame = 2
Query:  215 ISAVHAADSAKPPSAVKTTTKAPEPVL----KTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVK-VGRMAGQFAKPRSD 667
            +SAVHAAD AK    V+   KA  P      +   VG  KWTVDSWK+KKALQLPEYP++EEL+SVLKT++ FPP+VFAG             MG+AF+LQGGDCAESFKEFNANNIRDTFRILLQMG VLMFGGQMPVVK VGRMAGQFAKPRSD
Sbjct:   38 VSAVHAADPAKSNGPVQAAAKASSPSTVAAPEKKPVGLGKWTVDSWKAKKALQLPEYPSQEELDSVLKTIETFPPVVFAGEARHLEERLADAAMGRAFVLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVVKVVGRMAGQFAKPRSD 193          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROG_SOLTU (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Solanum tuberosum GN=SHKB PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.630e-51
Identity = 113/195 (57.95%), Postives = 132/195 (67.69%), Query Frame = 2
Query:  113 MALVGSTSITPTKS---------SFVQPQSQPFITKPRSNIHPISAVHAADSAKPPSAVKTTTKAPEPVLKTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSDP 670
            MAL  + S++ +KS            QP+   F T      HPISAVHAA+ +K  +AVK                  KW++DSWK+KKALQLPEYP+++ELESVLKTL+  PP+VFAG             +GKAFLLQGGDCAESFKEFNANNIRDTFRILLQM VVLMFGGQ+PV+KVGRMAGQFAKPRSDP
Sbjct:    1 MALSNTLSLSSSKSLVQSHLLHNPLPQPRFSLFPTTQHGRRHPISAVHAAEPSK--TAVKQG----------------KWSLDSWKTKKALQLPEYPDEKELESVLKTLEMNPPLVFAGEARSLEEKLGEAALGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMSVVLMFGGQVPVIKVGRMAGQFAKPRSDP 177          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROF_SOLLC (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.487e-51
Identity = 113/195 (57.95%), Postives = 132/195 (67.69%), Query Frame = 2
Query:  113 MALVGSTSITPTKSSFV---------QPQSQPFITKPRSNIHPISAVHAADSAKPPSAVKTTTKAPEPVLKTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSDP 670
            MAL  + S++ +KS            QP+   F T      HPISAVHAA+ +K  +AVK                  KW++DSWK+KKALQLPEYP+++ELESVLKTL+  PP+VFAG             +GKAFLLQGGDCAESFKEFNANNIRDTFRILLQM VVLMFGGQ+PV+KVGRMAGQFAKPRSDP
Sbjct:    1 MALSNTLSLSSSKSLVQSHLLHNPTPQPRFSLFPTTQHGRRHPISAVHAAEPSK--TAVKQG----------------KWSLDSWKTKKALQLPEYPDEKELESVLKTLEMNPPLVFAGEARSLEEKLGEAALGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMSVVLMFGGQVPVIKVGRMAGQFAKPRSDP 177          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROF_ORYSJ (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=DAHPS1 PE=2 SV=2)

HSP 1 Score: 196.052 bits (497), Expect = 1.443e-49
Identity = 108/205 (52.68%), Postives = 131/205 (63.90%), Query Frame = 2
Query:  116 ALVGSTSITPTKSSFVQPQSQPFITKPRSNIHPISAVHAADSAKPP-----SAVKTTTK------------APEPVLK----TSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSD 667
            ++ G  ++ P  ++     +  F+T  R     + AVHAA+ +K P     SA KT++             AP PV      T  V P +W VDSW++KKALQLPEYPN  ELE+VLKT++ FPPIVFAG             MG+AFLLQGGDCAESFKEFN NNIRDTFR+LLQM  VL FGGQMPV+KVGRMAGQFAKPRS+
Sbjct:    8 SMAGGAAVVPRSATATTASA--FVTMKR-RATAVRAVHAAEPSKNPPVGVPSAAKTSSPSVAAPEKAPVAAAPAPVAPAPAATKQVAPARWAVDSWRTKKALQLPEYPNAAELEAVLKTIEAFPPIVFAGEARHLEERLADAAMGRAFLLQGGDCAESFKEFNGNNIRDTFRVLLQMSAVLTFGGQMPVIKVGRMAGQFAKPRSE 209          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROF_ARATH (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=DHS1 PE=2 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 3.215e-49
Identity = 100/160 (62.50%), Postives = 121/160 (75.62%), Query Frame = 2
Query:  188 TKPRSNIHPISAVHAADSAKPPSAVKTTTKAPEPVLKTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSD 667
            TKP+S ++ ++AVHAA+ A+   +VK +       + +S+ G  KWT +SWK KKALQLP+YPN  ELESVLKT++ FPPIVFAG             +GKAFLLQGGDCAESFKEFNA NIRDTFR+LLQM +VL FGGQ+PV+KVGRMAGQFAKPRSD
Sbjct:   38 TKPKS-VNLVTAVHAAEPARNAVSVKES-------VASSSSGALKWTPESWKLKKALQLPDYPNANELESVLKTIEAFPPIVFAGEARNLEERLADAAVGKAFLLQGGDCAESFKEFNATNIRDTFRVLLQMSIVLTFGGQVPVIKVGRMAGQFAKPRSD 189          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROG_ARATH (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=DHS2 PE=2 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 7.920e-48
Identity = 101/188 (53.72%), Postives = 125/188 (66.49%), Query Frame = 2
Query:  113 MALVGSTSITPTKSSFVQPQSQPFITKPRSNIH--PISAVHAADSAKPPSAVKTTTKAPEPVLKTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSDP 670
            M  + ++S   TKS        P+   PR  I   P+ AVH+ D  K   +   + K               W+++SWKSKKALQLP+YP++++++SVL+TL  FPPIVFAG             MG+AF+LQGGDCAESFKEFNANNIRDTFR+LLQMGVVLMFGGQ+PV+KVGRMAGQFAKPRSDP
Sbjct:    1 MVTLNASSPLTTKSFL------PYRHAPRRPISFSPVFAVHSTDPKKSTQSASASVK---------------WSLESWKSKKALQLPDYPDQKDVDSVLQTLSSFPPIVFAGEARKLEDKLGQAAMGQAFMLQGGDCAESFKEFNANNIRDTFRVLLQMGVVLMFGGQLPVIKVGRMAGQFAKPRSDP 167          
BLAST of FC930896 vs. ExPASy Swiss-Prot
Match: AROF_CATRO (Probable phospho-2-dehydro-3-deoxyheptonate aldolase, chloroplastic OS=Catharanthus roseus GN=DHS1 PE=2 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.315e-31
Identity = 81/160 (50.62%), Postives = 95/160 (59.38%), Query Frame = 2
Query:  191 KPRSNIHPISAVHAADSAKPPSAVKTTTKAPEPVLKTSNVGPQKWTVDSWKSKKALQLPEYPNKEELESVLKTLDDFPPIVFAGXXXXXXXXXXXXXMGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPRSDP 670
            KPRS+    +AVH     K P +  T TK    +L         W  +SWKSKKALQLPEYP++ +L+ VLKT++ FPP+VFAG             MG AFLLQGGDCAESFKE      R  F+        L FGGQ PV+KVGRMAGQFAKPR DP
Sbjct:   36 KPRSSRPISAAVHVTQPPKTPISSATATKRRLSLLNGV------W--ESWKSKKALQLPEYPDEGKLDGVLKTIEAFPPLVFAGEARSLEEKLAQAAMGNAFLLQGGDCAESFKELMPLYSR-YFQNTASDECRLTFGGQCPVIKVGRMAGQFAKPRLDP 186          
The following BLAST results are available for this feature:
BLAST of FC930896 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
AROF_TOBAC3.208e-5759.80Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROF_SOLTU1.348e-5563.30Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_SOLLC1.760e-5557.62Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROG_ORYSJ2.379e-5268.59Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROG_SOLTU2.630e-5157.95Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_SOLLC4.487e-5157.95Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROF_ORYSJ1.443e-4952.68Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROF_ARATH3.215e-4962.50Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_ARATH7.920e-4853.72Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_CATRO2.315e-3150.63Probable phospho-2-dehydro-3-deoxyheptonate aldola... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110B12EF PostHarvP1 Citrus clementina cDNA clone C34110B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930896 ID=FC930896|Name=FC930896|organism=Citrus clementina|type=EST|length=671bp
GAGGTTCCTCTTTCACGATAAAGAGTTAAAGAGCCTCCGTTTATTTGAAA
AAAAAAAGGGAAAAAAAGAAATTCGTTTCATTTACATTTCAACAAAAATA
AATTAGAACATTATGGCTCTCGTTGGCAGTACTTCAATTACTCCCACAAA
ATCATCCTTCGTTCAGCCACAATCTCAGCCGTTCATCACCAAACCCAGAT
CAAATATCCATCCCATCTCCGCCGTCCATGCTGCTGACTCTGCCAAGCCA
CCGTCTGCCGTAAAAACCACAACAAAGGCACCCGAGCCAGTCCTCAAGAC
CAGCAATGTGGGTCCCCAAAAATGGACGGTTGACAGCTGGAAATCCAAGA
AGGCTTTGCAGCTGCCGGAGTATCCAAACAAAGAGGAGCTCGAGTCCGTG
CTGAAAACGCTCGACGATTTCCCGCCGATTGTGTTCGCCGGTGAAGCCAG
GAGCTTGGAGGAGCGGCTAGCTGAAGCCGCCATGGGCAAAGCTTTCTTGC
TTCAAGGCGGTGATTGCGCTGAGAGTTTCAAAGAGTTTAATGCTAATAAC
ATTCGTGACACTTTCAGAATCCTTCTCCAGATGGGTGTTGTGCTAATGTT
CGGCGGTCAAATGCCCGTTGTTAAGGTGGGAAGAATGGCAGGGCAGTTTG
CGAAGCCGAGATCAGATCCGT
back to top