FC930900

Overview
NameFC930900
Unique NameFC930900
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCA1_YEAST (Branched-chain-amino-acid aminotransferase, mitochondrial OS=Saccharomyces cerevisiae GN=BAT1 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.779e-46
Identity = 82/145 (56.55%), Postives = 107/145 (73.79%), Query Frame = 2
Query:  242 LDASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            LDASKL IT+   P +P  +++LVFG+ FTDHML++ W+A +GW  P I PY NL LDP+ CVFHYAFE FEG+KAY+     I +FRP+KNM R+NKS+ARI LPT + + L K+ G+L++ D   +P   GYSLY+RPTMIGT
Sbjct:   23 LDASKLKITRNPNPSKPRPNEELVFGQTFTDHMLTIPWSAKEGWGTPHIKPYGNLSLDPSACVFHYAFELFEGLKAYRTPQNTITMFRPDKNMARMNKSAARICLPTFESEELIKLTGKLIEQDKHLVPQGNGYSLYIRPTMIGT 167          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCA2_YEAST (Branched-chain-amino-acid aminotransferase, cytosolic OS=Saccharomyces cerevisiae GN=BAT2 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.428e-44
Identity = 84/148 (56.76%), Postives = 106/148 (71.62%), Query Frame = 2
Query:  233 LPGLDASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            L  LDASK+ IT T    +P  + +LVFGK FTDHML+ EWTA  GW  P I PYQNL LDP+  VFHYAFE FEGMKAY+     I +FRP+ NM+R+NKS+ RI LPT D + L  +IG+L++ D   +P+ +GYSLY+RPT+IGT
Sbjct:    3 LAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWGTPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKRMNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT 150          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCAT_MONBE (Branched-chain-amino-acid aminotransferase OS=Monosiga brevicollis GN=37018 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.740e-42
Identity = 87/149 (58.39%), Postives = 103/149 (69.13%), Query Frame = 2
Query:  230 QLPGLDASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            +L  LDASKLTI  TT P+E ++   LVFG  F+DHML  +W   +GW AP I PY NL L P++ V HYA ECFEGMKA++     IRLFRPN NM+RL++SS R+ALP  D D L K I ELV  D  +IP  RGYSLYLRPT IGT
Sbjct:   25 RLSTLDASKLTIETTTQPRERVEKTKLVFGHTFSDHMLKCKWDVNEGWAAPTISPYANLSLAPSSIVLHYAIECFEGMKAFRGDDDRIRLFRPNLNMDRLHRSSVRLALPDFDQDELLKCITELVIKDKDWIPAGRGYSLYLRPTHIGT 173          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCAT_DICDI (Branched-chain-amino-acid aminotransferase OS=Dictyostelium discoideum GN=bcaA PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.600e-38
Identity = 75/146 (51.37%), Postives = 102/146 (69.86%), Query Frame = 2
Query:  242 LDASKLTITKTTTP-KEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            ++ ++L + KT TP ++  D   LVFGK F+DHM+ V+WT  +GW  P+I  Y NL + P+  V HYA ECFEGMKAYKDS G IRLFRP++NM R   S+ RI LP  + +A+ ++I +L  LD  +IP+ +GYSLYLRPT+I T
Sbjct:   16 INVNELIVEKTKTPFQKYTDKTKLVFGKQFSDHMIEVQWTKEEGWGVPKISGYHNLSIPPSASVLHYALECFEGMKAYKDSNGKIRLFRPDQNMNRFLNSAKRICLPEFNKEAVIELIKKLCVLDKDWIPEGKGYSLYLRPTLIAT 161          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCAT_NEMVE (Branched-chain-amino-acid aminotransferase OS=Nematostella vectensis GN=v1g246094 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.092e-36
Identity = 72/145 (49.66%), Postives = 94/145 (64.83%), Query Frame = 2
Query:  242 LDASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            + +S L I KT  PK   D   LVFGK FTDH L ++W+  DGW  P+I+PY NL L PA    HY  ECFEGMKAY+   G IR+FRP  NM+R+N S+AR  LPT +   + + I +L+ L+  ++P +   SLY+RPTMIGT
Sbjct:   43 IKSSNLLIEKTNKPKPKPDPNTLVFGKEFTDHALILKWSDEDGWDNPQIIPYGNLSLPPAASALHYGLECFEGMKAYRGDDGKIRMFRPLMNMKRMNNSAARACLPTFNSGEMVECIRKLIHLEREWVPHSNTCSLYIRPTMIGT 187          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCA1_SCHPO (Branched-chain-amino-acid aminotransferase, mitochondrial OS=Schizosaccharomyces pombe GN=eca39 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 4.151e-36
Identity = 72/145 (49.66%), Postives = 95/145 (65.52%), Query Frame = 2
Query:  242 LDASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            +D+S + +T     K   + K L FG+ FTDHML ++W    GW  P IVP+  L   PA+ VFHY FECFEGMKA++D  G  RLFRP KN ER+  +  RI+LP+ D   L +II + V  ++R++PD RGYSLY+RPT IGT
Sbjct:   13 MDSSHIKVTNVKELKPLPEWKSLKFGENFTDHMLIMKWNREKGWSTPEIVPFGKLCFHPASSVFHYGFECFEGMKAFRDEKGVPRLFRPIKNAERMLSTGTRISLPSFDPAELAEIIRKFVAHENRWVPDQRGYSLYIRPTFIGT 157          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCAT1_SHEEP (Branched-chain-amino-acid aminotransferase, cytosolic OS=Ovis aries GN=BCAT1 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.975e-34
Identity = 73/143 (51.05%), Postives = 90/143 (62.94%), Query Frame = 2
Query:  248 ASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            A  L IT+ T  KE  D   LVFG  FTDHML+VEW+   GW  PRI P QNL L P +   HYA E FEG+KA++     IRLFRPN NM+R+ +S+ R  LP  D   L + I +LVKLD  ++P +   SLY+RPT IGT
Sbjct:   26 AEDLIITRATILKEKPDPSTLVFGTVFTDHMLTVEWSLELGWEKPRIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFRPNLNMDRMYRSAMRATLPAFDKKELLECIQQLVKLDEEWVPYSTSASLYIRPTFIGT 168          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCAT1_HUMAN (Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens GN=BCAT1 PE=1 SV=3)

HSP 1 Score: 143.665 bits (361), Expect = 8.656e-34
Identity = 70/143 (48.95%), Postives = 91/143 (63.64%), Query Frame = 2
Query:  248 ASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            A  L +T  T  KE  D  +LVFG  FTDHML+VEW++  GW  P I P QNL L P +   HYA E FEG+KA++     IRLF+PN NM+R+ +S+ R  LP  D + L + I +LVKLD  ++P +   SLY+RPT IGT
Sbjct:   27 AKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGT 169          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCAT1_MOUSE (Branched-chain-amino-acid aminotransferase, cytosolic OS=Mus musculus GN=Bcat1 PE=2 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 1.476e-33
Identity = 70/143 (48.95%), Postives = 92/143 (64.34%), Query Frame = 2
Query:  248 ASKLTITKTTTPKEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIGT 676
            A  L IT  T  KE  D   LVFG  FTDHML+VEW++A GW  P I P+ NL + PA  V HYA E FEG+KA++     IRLFRP+ NM+R+ +S+ R  LP  D + L K I +L+++D  ++P +   SLY+RPT IGT
Sbjct:   27 AKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGT 169          
BLAST of FC930900 vs. ExPASy Swiss-Prot
Match: BCAT2_RAT (Branched-chain-amino-acid aminotransferase, mitochondrial OS=Rattus norvegicus GN=Bcat2 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.632e-32
Identity = 68/143 (47.55%), Postives = 93/143 (65.03%), Query Frame = 2
Query:  248 ASKLTITKTTTP-KEPMDSKDLVFGKYFTDHMLSVEWTAADGWHAPRIVPYQNLILDPATCVFHYAFECFEGMKAYKDSTGGIRLFRPNKNMERLNKSSARIALPTVDGDALTKIIGELVKLDSRFIPDARGYSLYLRPTMIG 673
            A+ L +  T  P K+P  S+ L+FGK FTDHML VEW +  GW  PRI P+QNL L PA    HY+ + FEG+KAYK     +RLFRP  NM+R+ +S+ R+ LP  D   L + I +L+++D  ++PD  G SLY+RP +IG
Sbjct:   34 AADLQVQVTREPQKKPAPSQPLLFGKTFTDHMLMVEWNSKTGWGPPRIQPFQNLTLHPACSGLHYSLQLFEGLKAYKGRDKQVRLFRPWLNMDRMLRSARRLCLPDFDKQELLECIRQLIEVDKDWVPDGNGTSLYVRPVLIG 176          
The following BLAST results are available for this feature:
BLAST of FC930900 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
BCA1_YEAST5.779e-4656.55Branched-chain-amino-acid aminotransferase, mitoch... [more]
BCA2_YEAST2.428e-4456.76Branched-chain-amino-acid aminotransferase, cytoso... [more]
BCAT_MONBE1.740e-4258.39Branched-chain-amino-acid aminotransferase OS=Mono... [more]
BCAT_DICDI2.600e-3851.37Branched-chain-amino-acid aminotransferase OS=Dict... [more]
BCAT_NEMVE1.092e-3649.66Branched-chain-amino-acid aminotransferase OS=Nema... [more]
BCA1_SCHPO4.151e-3649.66Branched-chain-amino-acid aminotransferase, mitoch... [more]
BCAT1_SHEEP2.975e-3451.05Branched-chain-amino-acid aminotransferase, cytoso... [more]
BCAT1_HUMAN8.656e-3448.95Branched-chain-amino-acid aminotransferase, cytoso... [more]
BCAT1_MOUSE1.476e-3348.95Branched-chain-amino-acid aminotransferase, cytoso... [more]
BCAT2_RAT1.632e-3247.55Branched-chain-amino-acid aminotransferase, mitoch... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110C04EF PostHarvP1 Citrus clementina cDNA clone C34110C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930900 ID=FC930900|Name=FC930900|organism=Citrus clementina|type=EST|length=676bp
GGAGCTTCGCAGGGATACTGCACTGTAGTTCTGGTGTCGAGTCATCTTTC
TAGTTGTTATTTTTTAAATCCCCATTGACTTCCTTGATATCATCATGAAG
TCGCTTCACCAATTTGCTCGCCGACAGGCATTGACCGGGCTCGCAATGCC
CCGCGTCCTCTCATCCCAGAAAATTGCCGCCAGCCAAACATGGCTGAGAG
CTTTCAGTGCCTCCAGAGCAGCCGCCTCCCAGCTCCCGGGTCTTGACGCT
TCGAAATTGACGATCACCAAGACCACCACCCCGAAGGAGCCAATGGACTC
TAAGGATCTTGTCTTTGGTAAATACTTCACAGATCATATGCTCTCTGTGG
AGTGGACGGCTGCCGATGGATGGCACGCACCTCGCATTGTTCCCTACCAG
AACCTCATCTTAGATCCTGCAACCTGTGTGTTCCACTATGCATTTGAATG
TTTCGAGGGCATGAAGGCATACAAGGACAGCACCGGCGGCATCCGTTTGT
TTCGCCCCAACAAGAACATGGAACGCCTAAACAAGTCGTCTGCGCGCATT
GCTCTTCCTACCGTGGACGGTGATGCACTAACAAAAATAATTGGAGAGCT
TGTGAAGCTCGACAGTCGGTTCATCCCGGATGCTCGCGGCTACTCCTTGT
ACCTGCGCCCTACCATGATTGGTACC
back to top