FC930903

Overview
NameFC930903
Unique NameFC930903
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15233 contig Ccv1_Contig15233:1..715. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: AROD2_ARATH (Arogenate dehydratase/prephenate dehydratase 2, chloroplastic OS=Arabidopsis thaliana GN=ADT2 PE=1 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 8.283e-62
Identity = 135/217 (62.21%), Postives = 152/217 (70.05%), Query Frame = 1
Query:   52 SVARSQLTPLSRQITAKPSQSDQTPK-CIVRFRPLNIPRRFNVAVKASINRNDEKIGGNNNKTAPALHPQSIXXXXXXXXXXXXXXNSLPRPLSSAQFSNFVSNGSRLRVAYQGVRGAYSESAAEKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQCE 699
            +V  S  T L   I++  S  ++ P   IVR+   +  R   V V AS+  ND    G +N    A+  + I                LP+PLSS Q +  VSNGSR+RVAYQGVRGAYSESAAEKAYPNCEAVPCE+FDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRH LHIVGEVK AVRHCLLAN GV +EDL+RV SHPQALAQCE
Sbjct:    5 TVRLSPATQLHGGISSNLSPPNRKPNNSIVRYGCGSSKRFRIVTVLASLRENDAN--GRDNSVR-AMEVKKIFEDSPL----------LPKPLSSNQLTESVSNGSRVRVAYQGVRGAYSESAAEKAYPNCEAVPCEEFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHNLHIVGEVKLAVRHCLLANHGVNIEDLRRVLSHPQALAQCE 208          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: AROD6_ARATH (Arogenate dehydratase/prephenate dehydratase 6, chloroplastic OS=Arabidopsis thaliana GN=ADT6 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.791e-48
Identity = 92/127 (72.44%), Postives = 104/127 (81.89%), Query Frame = 1
Query:  319 RPLSSAQFSNFVSNGSRLRVAYQGVRGAYSESAAEKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQCE 699
            +PLS    S    +GS LRVAYQGV GAYSE+AA KAYPNC+A+PC+QF+ AF+AVE W+ DRAVLP+ENSLGGSIHRNYDLLLRHRLHIVGEV+  V HCLLA PGV+ E L RV SHPQ LAQCE
Sbjct:   99 KPLSMTDLSPAPMHGSNLRVAYQGVPGAYSEAAAGKAYPNCQAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEFLTRVISHPQGLAQCE 225          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: AROD3_ARATH (Arogenate dehydratase 3, chloroplastic OS=Arabidopsis thaliana GN=ADT3 PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.056e-48
Identity = 91/127 (71.65%), Postives = 105/127 (82.68%), Query Frame = 1
Query:  319 RPLSSAQFSNFVSNGSRLRVAYQGVRGAYSESAAEKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQCE 699
            +PLS +  S    +GS LRVAYQGV GAYSE+AA KAYPNC+A+PC+QF+ AF+AVE W+ DRAVLP+ENSLGGSIHRNYDLLLRHRLHIVGEV+  V HCL+A PGV+ E L RV SHPQ LAQCE
Sbjct:  104 KPLSISDLSPAPMHGSNLRVAYQGVPGAYSEAAAGKAYPNCQAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLIALPGVRKEFLTRVISHPQGLAQCE 230          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: AROD5_ARATH (Arogenate dehydratase 5, chloroplastic OS=Arabidopsis thaliana GN=ADT5 PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.412e-47
Identity = 92/129 (71.32%), Postives = 105/129 (81.40%), Query Frame = 1
Query:  313 LPRPLSSAQFSNFVSNGSRLRVAYQGVRGAYSESAAEKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQCE 699
            L +PL+    S   S+GS LRVAYQGV GAYSE+AA KAYPN EA+PC+QFD AF+AVE W+ DRAVLP+ENSLGGSIHRNYDLLLRHRLHIVGEV+  V HCLLA PGV+ + + RV SHPQALAQ E
Sbjct:  107 LIQPLTITDLSPAPSHGSTLRVAYQGVPGAYSEAAAGKAYPNSEAIPCDQFDVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCITRVISHPQALAQTE 235          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: AROD4_ARATH (Arogenate dehydratase 4, chloroplastic OS=Arabidopsis thaliana GN=ADT4 PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.412e-47
Identity = 90/127 (70.87%), Postives = 104/127 (81.89%), Query Frame = 1
Query:  319 RPLSSAQFSNFVSNGSRLRVAYQGVRGAYSESAAEKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQCE 699
            +PL+    S    +GS LRVAYQGV GAYSE+AA KAYPNC+A+PC+QFD AF+AVE W+ DRAVLP+ENSLGGSIHRNYDLLLRHRLHIVGEV+  V HCLLA PGV+ + + RV SHPQALAQ E
Sbjct:  108 QPLTITDLSPAPLHGSSLRVAYQGVPGAYSEAAAGKAYPNCDAIPCDQFDVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCVSRVISHPQALAQTE 234          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: AROD1_ARATH (Arogenate dehydratase/prephenate dehydratase 1, chloroplastic OS=Arabidopsis thaliana GN=ADT1 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.854e-45
Identity = 86/128 (67.19%), Postives = 104/128 (81.25%), Query Frame = 1
Query:  313 LPRPLSSAQFSNFVSNGSRLRVAYQGVRGAYSESAAEKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQC 696
            LP+PL++    +   + S++R+++QG+ GAYSE+AA KA+PNCE VPCEQF+ AF+AVE WLVD+AVLPIENS+GGSIHRNYDLLLRHRLHIV EV   V HCLL  PGVK ED+K V SHPQAL QC
Sbjct:   87 LPKPLTANSLYSSDGDDSKVRISFQGIPGAYSETAALKAFPNCETVPCEQFEAAFQAVELWLVDKAVLPIENSVGGSIHRNYDLLLRHRLHIVQEVHLPVNHCLLGVPGVKKEDIKCVLSHPQALDQC 214          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: PHEA_BUCAP (P-protein OS=Buchnera aphidicola subsp. Schizaphis graminum GN=pheA PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.531e-15
Identity = 47/131 (35.88%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  325 LSSAQFSNFVSNGSRLRVA---YQGVRGAYSESAA----EKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQC 696
            L+  +  N   N + L +A   + G +G+YS  AA    E+ +  C    C  F+   ++VE    D AVLPIENS  G I+  +D+L +  L I+GE+  ++ HCLLA   +++  +K V SHPQ   QC
Sbjct:   86 LTQKKLLNKFCNDNNLDLASFSFLGPKGSYSHIAASQYAEQNFKTCIENACLSFNEVIQSVENNQTDYAVLPIENSCSGFINEIFDILKKTNLFIIGEINISINHCLLAIKKIELNKIKAVYSHPQPFQQC 216          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: PHEA_HAEIN (P-protein OS=Haemophilus influenzae GN=pheA PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.921e-15
Identity = 40/113 (35.40%), Postives = 62/113 (54.87%), Query Frame = 1
Query:  370 LRVAYQGVRGAYSESAAEKAYPNCEA----VPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQC 696
            L +A+ G RG+YS  AA       +     + C+ F+  FE V+    D  VLP+EN+  G+I+  YDLL    L +VGE+ + ++HC+L N    +  +  + SHPQ + QC
Sbjct:  104 LHIAFLGKRGSYSNLAARNYAARYQKQFVELGCQSFEQVFEKVQTGEADFGVLPLENTTSGAINEVYDLLQHTDLSLVGELAYPIKHCVLVNDKTDLNQIDTLYSHPQVIQQC 216          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: PHEA_ENTAG (P-protein OS=Enterobacter agglomerans GN=pheA PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.887e-14
Identity = 42/112 (37.50%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  373 RVAYQGVRGAYSESAAE----KAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQC 696
            R+A+ G +G+YS  AA     + + +     C +F    + VE  + D AV+PIEN+  GSI+  YDLL +  L IVGE+   + HC+L N    ++ ++ V SHPQ   QC
Sbjct:  105 RIAFLGPKGSYSHLAARNYASRHFDSMVECGCLKFHDIIKQVENGVADYAVMPIENTSSGSINDVYDLLQQTSLSIVGELTLPIDHCVLVNGPTDLQQIETVYSHPQPFQQC 216          
BLAST of FC930903 vs. ExPASy Swiss-Prot
Match: PHEA_PSEAE (P-protein OS=Pseudomonas aeruginosa GN=pheA PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.399e-14
Identity = 40/110 (36.36%), Postives = 61/110 (55.45%), Query Frame = 1
Query:  370 LRVAYQGVRGAYSESAAEKAYPNCE-AVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLLRHRLHIVGEVKFAVRHCLLANPGVKVEDLKRVXSHPQALAQC 696
            L+VAY G  G ++++AA K + N   + P    D  F  V    V+  V+P+ENS  G+++   D  L H + I GEV+  + H LL     K +++ R+ SH Q+LAQC
Sbjct:   95 LKVAYLGPEGTFTQAAALKHFGNAVISTPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGETTKTDNITRIYSHAQSLAQC 204          
The following BLAST results are available for this feature:
BLAST of FC930903 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
AROD2_ARATH8.283e-6262.21Arogenate dehydratase/prephenate dehydratase 2, ch... [more]
AROD6_ARATH1.791e-4872.44Arogenate dehydratase/prephenate dehydratase 6, ch... [more]
AROD3_ARATH3.056e-4871.65Arogenate dehydratase 3, chloroplastic OS=Arabidop... [more]
AROD5_ARATH4.412e-4771.32Arogenate dehydratase 5, chloroplastic OS=Arabidop... [more]
AROD4_ARATH4.412e-4770.87Arogenate dehydratase 4, chloroplastic OS=Arabidop... [more]
AROD1_ARATH1.854e-4567.19Arogenate dehydratase/prephenate dehydratase 1, ch... [more]
PHEA_BUCAP1.531e-1535.88P-protein OS=Buchnera aphidicola subsp. Schizaphis... [more]
PHEA_HAEIN9.921e-1535.40P-protein OS=Haemophilus influenzae GN=pheA PE=4 S... [more]
PHEA_ENTAG2.887e-1437.50P-protein OS=Enterobacter agglomerans GN=pheA PE=4... [more]
PHEA_PSEAE8.399e-1436.36P-protein OS=Pseudomonas aeruginosa GN=pheA PE=3 S... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110C07EF PostHarvP1 Citrus clementina cDNA clone C34110C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930903 ID=FC930903|Name=FC930903|organism=Citrus clementina|type=EST|length=715bp
AAGTCACCCGTGGCTGAGTCTCGCTGTCTCACGCGTTGATTAATGGCGGC
CTCCGTTGCGCGATCACAGCTGACCCCACTTTCGCGACAGATCACTGCTA
AACCCTCTCAGTCGGATCAAACACCAAAATGCATCGTCAGATTCCGTCCG
CTTAACATCCCACGGCGGTTTAACGTTGCCGTTAAGGCCTCTATTAACCG
AAACGATGAGAAAATCGGCGGTAACAATAACAAAACCGCTCCGGCGCTTC
ACCCGCAGAGCATTCTCGATGATGATGAAGAGGACGCCGCTTCGAATGAT
TCGTTGAATTCGCTTCCCCGGCCTTTGTCTTCGGCTCAGTTTTCAAATTT
TGTATCCAACGGGTCCCGCCTTCGAGTTGCGTACCAGGGAGTTCGTGGAG
CTTACAGCGAGTCAGCAGCAGAGAAAGCATACCCAAATTGCGAAGCGGTT
CCTTGCGAGCAATTTGACACTGCTTTTGAAGCTGTCGAGAGGTGGCTTGT
AGACAGAGCAGTTTTACCCATTGAGAATTCTTTGGGTGGCAGCATCCACA
GAAATTATGATCTCTTACTCCGGCACAGGTTGCACATAGTAGGGGAAGTT
AAATTTGCTGTCCGACACTGCCTACTAGCCAATCCTGGTGTTAAAGTTGA
GGACTTGAAAAGGGTTCNTAGCCATCCTCAGGCTCTTGCTCAATGTGAGA
CACACTAACGAAATT
back to top