FC930905

Overview
NameFC930905
Unique NameFC930905
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length671
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:621..1291. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 430.254 bits (1105), Expect = 4.547e-120
Identity = 209/219 (95.43%), Postives = 217/219 (99.09%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIP +PMVVET
Sbjct:  184 NPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 1.120e-118
Identity = 205/219 (93.61%), Postives = 215/219 (98.17%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIG VPVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIP +PMVVET
Sbjct:  184 NPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGIVPVGRVETGVVKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 5.559e-118
Identity = 204/219 (93.15%), Postives = 214/219 (97.72%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG VASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKMIP +PMVVET
Sbjct:  184 NPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGIVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 9.481e-118
Identity = 203/219 (92.69%), Postives = 216/219 (98.63%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGMVKMIP +PMVVET
Sbjct:  184 NPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 2.759e-117
Identity = 205/219 (93.61%), Postives = 214/219 (97.72%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+KVPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELE  PKFLKNGDAG+VKMIP +PMVVET
Sbjct:  184 NPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 2.759e-117
Identity = 204/219 (93.15%), Postives = 215/219 (98.17%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+ FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VAS SKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+P +PMVVET
Sbjct:  184 NPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 3.603e-117
Identity = 203/219 (92.69%), Postives = 215/219 (98.17%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD IN+ KRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIP +PMVVET
Sbjct:  184 NPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 8.026e-117
Identity = 202/219 (92.24%), Postives = 213/219 (97.26%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNV FNVKNVAVKDLK G VASNSKDDPA++AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIP +PMVVET
Sbjct:  184 NPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVRFNVKNVAVKDLKHGLVASNSKDDPAKDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.369e-116
Identity = 201/219 (91.78%), Postives = 214/219 (97.72%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NP+K+ F+PISGFEGDNMI+RSTNLDWYKGPTLL+ALD I+EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIP +PMVVET
Sbjct:  184 NPDKIAFIPISGFEGDNMIDRSTNLDWYKGPTLLEALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVET 402          
BLAST of FC930905 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 2.335e-116
Identity = 202/219 (92.24%), Postives = 213/219 (97.26%), Query Frame = 1
Query:   13 NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPHQPMVVET 669
            NPEK+ FVPISGFEGDNMIERSTNLDWYKGPTLLDALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNV+VKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+P +PMVVET
Sbjct:  184 NPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKPGMVVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVET 402          
The following BLAST results are available for this feature:
BLAST of FC930905 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ4.547e-12095.43Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_VICFA1.120e-11893.61Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_MANES5.559e-11893.15Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_SOLLC9.481e-11892.69Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_WHEAT2.759e-11793.61Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_MAIZE2.759e-11793.15Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_TOBAC3.603e-11792.69Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_PEA8.026e-11792.24Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A2_DAUCA1.369e-11691.78Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A1_DAUCA2.335e-11692.24Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110C09EF PostHarvP1 Citrus clementina cDNA clone C34110C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930905 ID=FC930905|Name=FC930905|organism=Citrus clementina|type=EST|length=671bp
CGGGGTTGGATCAACCCCGAGAAAGTCCCATTCGTGCCCATCTCTGGTTT
CGAGGGTGACAACATGATTGAGAGGTCTACAAACCTTGACTGGTACAAGG
GTCCAACCCTGCTGGACGCTCTTGACAATATCAATGAGCCGAAGAGGCCC
TCAGACAAGCCCCTTCGTCTGCCACTCCAGGACGTGTACAAGATTGGTGG
CATTGGAACCGTCCCAGTGGGTCGCGTTGAGACCGGTGTCCTCAAGCCTG
GTATGGTGGTGACATTTGGCCCCTCTGGATTGACAACTGAGGTTAAGTCT
GTTGAGATGCACCACGAAGCTCTGCAGGAGGCCCTTCCGGGTGACAATGT
TGGCTTCAACGTGAAGAACGTTGCTGTCAAGGATCTCAAGCGTGGTTTTG
TTGCTTCCAACTCGAAGGATGATCCGGCCAGGGAAGCTGCCAACTTCACC
TCACAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGC
CCCAGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGC
TCGTGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCC
AAGTTCTTGAAGAATGGAGACGCCGGAATGGTTAAGATGATTCCCCACCA
GCCCATGGTTGTTGAGACCTT
back to top