FC931058

Overview
NameFC931058
Unique NameFC931058
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length726
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15364 contig Ccv1_Contig15364:3..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_MOUSE (Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.364e-35
Identity = 74/141 (52.48%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  302 RRSFVVAAPSEPRKIEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            R   + AA  E    E  S  +YA C  GG+LSCGLTHTAV PLDLVKC MQ+DP KYK I +GF + LKE G+RG  +GW PTL+GYS QG C            S+I G E    ++T +YLA SASAEF AD AL P+
Sbjct:   38 RSRHLAAAAVEEYSCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPM 178          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_RAT (Phosphate carrier protein, mitochondrial OS=Rattus norvegicus GN=Slc25a3 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.781e-35
Identity = 74/141 (52.48%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  302 RRSFVVAAPSEPRKIEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            R   + AA  E    E  S  +YA C  GG+LSCGLTHTAV PLDLVKC MQ+DP KYK I +GF + LKE G+RG  +GW PTL+GYS QG C            S+I G E    ++T +YLA SASAEF AD AL P+
Sbjct:   37 RSRHLAAAAVEGYSCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLAASASAEFFADIALAPM 177          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_PONAB (Phosphate carrier protein, mitochondrial OS=Pongo abelii GN=SLC25A3 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.182e-35
Identity = 73/137 (53.28%), Postives = 86/137 (62.77%), Query Frame = 2
Query:  314 VVAAPSEPRKIEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            + AA  E    E  S  +YA C  GG+LSCGLTHTAV PLDLVKC MQ+DP KYK I +GF V LKE G+RG  +GW PT LGYS QG C            S++ G E    ++T +YLA SASAEF AD AL P+
Sbjct:   46 LAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPM 182          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_BOVIN (Phosphate carrier protein, mitochondrial OS=Bos taurus GN=SLC25A3 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.730e-34
Identity = 71/140 (50.71%), Postives = 87/140 (62.14%), Query Frame = 2
Query:  305 RSFVVAAPSEPRKIEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            R+   AA  E    +  S  F+  C +GGI+SCG THTA+ PLDLVKC MQ+DP KYKSI +GF V LKE G RG  +GW PT +GYS QG C            S++ G E A  ++T +YLA SASAEF AD AL P+
Sbjct:   44 RNLAAAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKSIFNGFSVTLKEDGFRGLAKGWAPTFIGYSLQGLCKFGFYEVFKVLYSNMLGEENAYLWRTSLYLAASASAEFFADIALAPM 183          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_HUMAN (Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.276e-33
Identity = 70/140 (50.00%), Postives = 86/140 (61.43%), Query Frame = 2
Query:  305 RSFVVAAPSEPRKIEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            R+   AA  E    +  S  F+  C +GGI+SCG THTA+ PLDLVKC MQ+DP KYK I +GF V LKE G+RG  +GW PT LGYS QG C            S++ G E    ++T +YLA SASAEF AD AL P+
Sbjct:   44 RNLAAAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPM 183          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_CAEEL (Phosphate carrier protein, mitochondrial OS=Caenorhabditis elegans GN=F01G4.6 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.407e-32
Identity = 66/135 (48.89%), Postives = 87/135 (64.44%), Query Frame = 2
Query:  320 AAPSEPRKIEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            +A S P ++E  S  +YA C +GG+LSCG+THTA+ PLDLVKC +Q++P KY  I++GF   + E+G R   +GW PTLLGYSAQG              +D+ G E A  Y+T +YLA SASAEF AD  L P+
Sbjct:   27 SAVSAPGQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEFFADILLAPM 161          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_CHOFU (Phosphate carrier protein, mitochondrial OS=Choristoneura fumiferana PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.148e-32
Identity = 64/126 (50.79%), Postives = 84/126 (66.67%), Query Frame = 2
Query:  347 EMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            E  S  ++A C +GGILSCG+THTAV PLDLVKC +Q+D  KYK++ +GF V ++E+G+RG  +GW PT +GYS QG C            +++   E A  Y+T +YLA SASAEF AD AL PL
Sbjct:   42 EFGSTKYFALCGLGGILSCGITHTAVVPLDLVKCRLQVDADKYKNVVNGFRVSVREEGLRGLAKGWAPTFIGYSLQGLCKFGLYEVFKVQYNNMLDEETAYTYRTFVYLAASASAEFFADIALSPL 167          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MPCP_SCHPO (Probable mitochondrial phosphate carrier protein OS=Schizosaccharomyces pombe GN=SPBC1703.13c PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.725e-30
Identity = 60/134 (44.78%), Postives = 89/134 (66.42%), Query Frame = 2
Query:  326 PSEPRK-IEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCPL 724
            P+ P+K +++Y+P +Y  CT+GG+L+CG TH+A+TPLDL+KC  Q++P  Y    +GF  +L ++G+RG + G +PTL+GYS QG              S + G + A +Y+T IYLA SASAE +AD  LCP+
Sbjct:    8 PAPPKKTLQLYTPQYYGLCTLGGLLACGTTHSAITPLDLIKCRKQVNPNIYPGNIAGFKTILSKEGLRGLYTGGMPTLIGYSLQGCGKYGFYELFKHKYSTLVGAQKAHEYRTSIYLAASASAELLADIMLCPM 141          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: PIC2_YEAST (Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae GN=PIC2 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.564e-23
Identity = 54/130 (41.54%), Postives = 77/130 (59.23%), Query Frame = 2
Query:  332 EPRKIEMYSPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCP 721
            +PRKI++Y+  FYA CT+GGI++CG TH+++TPLDLVKC +Q++P  Y S   GF  ++  +G +  + G+  T +GYS QGA             S    P         +YL  SA+AEF+AD  LCP
Sbjct:    6 QPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSP------GVTVYLMASATAEFLADIMLCP 129          
BLAST of FC931058 vs. ExPASy Swiss-Prot
Match: MCFN_DICDI (Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=3 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 5.207e-19
Identity = 50/122 (40.98%), Postives = 71/122 (58.20%), Query Frame = 2
Query:  356 SPAFYAACTVGGILSCGLTHTAVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWVPTLLGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLAGSASAEFIADXALCP 721
            +P+ +     GG LSC +TH+ V PLD+VK  +Q +P KY  + +GF  ++KEQG  G  +G  PT +GY+ QG              +D  G E A +++  I+LA SA+AE IAD ALCP
Sbjct:    6 TPSLFLKYGFGGALSCSITHSLVVPLDVVKTLLQTNPGKYTGMMNGFSTVIKEQGPSGLLQGLGPTAVGYALQGFLKFGFYEVFKKTYADAVG-EKADQFRIPIWLAASATAEVIADIALCP 126          
The following BLAST results are available for this feature:
BLAST of FC931058 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
MPCP_MOUSE1.364e-3552.48Phosphate carrier protein, mitochondrial OS=Mus mu... [more]
MPCP_RAT1.781e-3552.48Phosphate carrier protein, mitochondrial OS=Rattus... [more]
MPCP_PONAB5.182e-3553.28Phosphate carrier protein, mitochondrial OS=Pongo ... [more]
MPCP_BOVIN5.730e-3450.71Phosphate carrier protein, mitochondrial OS=Bos ta... [more]
MPCP_HUMAN1.276e-3350.00Phosphate carrier protein, mitochondrial OS=Homo s... [more]
MPCP_CAEEL2.407e-3248.89Phosphate carrier protein, mitochondrial OS=Caenor... [more]
MPCP_CHOFU9.148e-3250.79Phosphate carrier protein, mitochondrial OS=Choris... [more]
MPCP_SCHPO1.725e-3044.78Probable mitochondrial phosphate carrier protein O... [more]
PIC2_YEAST1.564e-2341.54Mitochondrial phosphate carrier protein 2 OS=Sacch... [more]
MCFN_DICDI5.207e-1940.98Mitochondrial substrate carrier family protein N O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34100H12EF PostHarvP1 Citrus clementina cDNA clone C34100H12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931058 ID=FC931058|Name=FC931058|organism=Citrus clementina|type=EST|length=726bp
GAAAAAGCGGAATTGCTTTTCCCGGGTTCTAACAAATTGGAAGCGAGAGA
CAGGAGGAGGAGAAGAGAAAGAGAAAATTAGAAGAATTCTCTCTGTCTCG
CTCTTTTTCTCTATAATTCAATCAAGCTTTTTACTCTCAAAATCAAATTT
CAAAAATTCCGAAATGGCCCTCACAGAATCTTATAGGAAAAACTCTCTGA
TACCAAGCTACCTCTACTCCTCCCAAACATCCTTCCCGTCCACGGCGGCT
TTCAATGGAGCGGCAGCAGCCGCCACGTCGCCGGCTACTCCATCCACGGC
GAGGAGGAGCTTCGTTGTTGCGGCACCGAGCGAGCCAAGGAAGATAGAGA
TGTACTCCCCTGCATTCTACGCCGCTTGTACCGTCGGCGGGATCCTCAGC
TGCGGTCTCACTCACACGGCCGTCACTCCTCTTGACCTCGTCAAGTGCAA
TATGCAGATTGATCCTGTTAAGTATAAAAGCATATCATCTGGTTTTGGAG
TTTTGCTCAAGGAACAGGGAATCAGGGGCTTCTTCAGGGGATGGGTACCT
ACCTTGCTTGGTTACAGCGCCCAAGGTGCTTGCAAGTTTGGATTCTACGA
GTTCTTCAAGAAGTACTACTCTGACATTGCTGGTCCAGAGTATGCTGCTA
AGTACAAGACTTTAATCTACCTTGCTGGCTCTGCTTCTGCTGAGTTCATT
GCTGATGNTGCTCTTTGCCCCCTTTG
back to top