FC931060

Overview
NameFC931060
Unique NameFC931060
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length669
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14610 contig Ccv1_Contig14610:16..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: AB34G_ARATH (ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 5.215e-108
Identity = 193/223 (86.55%), Postives = 210/223 (94.17%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            + +NYYVDMPAEMK +GV  DRLQLL  V GAFRPGVLTAL+GVSGAGKTTLMDVLAGRKTGGY+EG I ISGYPK Q TFARVSGYCEQ DIHSPHVT+YESL+YSAWLRLS+D+DTK R++FV+EVMELVELKPLR+++VGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFE+FDELLLM
Sbjct:  855 NNVNYYVDMPAEMKAQGVEGDRLQLLRDVGGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTGGYVEGSINISGYPKNQATFARVSGYCEQNDIHSPHVTVYESLIYSAWLRLSADIDTKTREMFVEEVMELVELKPLRNSIVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLM 1077          

HSP 2 Score: 89.7373 bits (221), Expect = 1.457e-17
Identity = 66/235 (28.09%), Postives = 113/235 (48.09%), Query Frame = 1
Query:   64 RLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG-YIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYS----------------------AWLRLSSDVDTKKRKIFV---------DEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLM 669
            ++++L  +SG  +P  +T L+G   +GKTTL+  LAG+      + G I   G+  ++    +   Y  Q D+H   +T+ ESL +S                      A ++   ++D   + I +         D V++L+ L    D LVG     G+S  QRKRLT    LV   + +FMDE ++GLD+     + + +R  V     T+V ++ QP+ + FE FD+++L+
Sbjct:  185 KIEILKDISGIIKPSRMTLLLGPPSSGKTTLLQALAGKLDDTLQMSGRITYCGHEFREFVPQKTCAYISQHDLHFGEMTVRESLDFSGRCLGVGTRYQLLTELSRREREAGIKPDPEIDAFMKSIAISGQETSLVTDYVLKLLGLDICADTLVGDVMRRGISGGQRKRLTTGEMLVGPATALFMDEISTGLDSSTTFQICKFMRQLVHIADVTMVISLLQPAPETFELFDDIILL 419          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: PDR1_TOBAC (Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 8.895e-108
Identity = 197/223 (88.34%), Postives = 206/223 (92.38%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            D + Y VDMP EMK +G GEDRL LL  VSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G+IKISGYPKKQETFAR+SGYCEQ DIHSP+VT+YESL+YSAWLRL  DVD K RK+FVDEVMELVEL PLR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDEL LM
Sbjct:  840 DDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGEIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDEKTRKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLM 1062          

HSP 2 Score: 87.8113 bits (216), Expect = 5.536e-17
Identity = 60/235 (25.53%), Postives = 115/235 (48.94%), Query Frame = 1
Query:   64 RLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAW----------------------LRLSSDVDT---------KKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLM 669
            +L +L  +SG  +P  +T L+G   +GKTTL+  LAG+      + G +  +G+   +    R + Y  Q D+H   +T+ E+L +SA                       ++  +D+D          ++  +  D V++++ L    D +VG   + G+S  Q+KR+T    LV     +FMDE ++GLD+     ++ ++R +V   + T V ++ QP+ + +  FD+++L+
Sbjct:  173 QLTILKDISGIIKPCRMTLLLGPPSSGKTTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSARCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDICADTMVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSLRQSVQILKGTAVISLLQPAPETYNLFDDIILL 407          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: AB39G_ARATH (ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.415e-107
Identity = 191/223 (85.65%), Postives = 209/223 (93.72%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            + +NYYVDMP+EMK +GV  DRLQLL  V GAFRPG+LTAL+GVSGAGKTTLMDVLAGRKTGGYIEG I ISGYPK Q TFARVSGYCEQ DIHSPHVT+YESL+YSAWLRLS+D+D K R++FV+EVMELVELKPLR+++VGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFE+FDELLLM
Sbjct:  856 NNVNYYVDMPSEMKAQGVEGDRLQLLRDVGGAFRPGILTALVGVSGAGKTTLMDVLAGRKTGGYIEGSISISGYPKNQTTFARVSGYCEQNDIHSPHVTVYESLIYSAWLRLSTDIDIKTRELFVEEVMELVELKPLRNSIVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLM 1078          

HSP 2 Score: 82.4185 bits (202), Expect = 2.326e-15
Identity = 61/235 (25.96%), Postives = 113/235 (48.09%), Query Frame = 1
Query:   64 RLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYS-------AWLRLSSDVDTKKRK------------------------IFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD-TGRTVVCTIHQPSIDIFEAFDELLLM 669
            ++Q+L  +SG  +P  +T L+G   +GKTTL+  LAG+      + G I   G+  ++    +   Y  Q D+H   +T+ E L +S       +  +L S++  ++++                        +  D V++++ L    D L G     G+S  Q+KRLT    LV     +FMDE ++GLD+     + + +R  V  +  T++ ++ QP+ + FE FD+++L+
Sbjct:  187 KIQILKDISGIVKPSRMTLLLGPPSSGKTTLLQALAGKLDDTLQMSGRITYCGHEFREFVPQKTCAYISQHDLHFGEMTVREILDFSGRCLGVGSRYQLMSELSRREKEEGIKPDPKIDAFMKSIAISGQETSLVTDYVLKILGLDICADILAGDVMRRGISGGQKKRLTTGEMLVGPARALFMDEISTGLDSSTTFQICKFMRQLVHISDVTMIISLLQPAPETFELFDDIILL 421          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: PDR7_ORYSJ (Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 7.530e-107
Identity = 196/223 (87.89%), Postives = 206/223 (92.38%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            D + Y VDMP EMK +GV EDRL LL  VSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDI ISGYPKKQETFAR++GYCEQ DIHSPHVT+YESLLYSAWLRL S+VD++ RK+FV+EVMELVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDEL LM
Sbjct:  849 DNIRYSVDMPQEMKDKGVTEDRLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDISISGYPKKQETFARIAGYCEQNDIHSPHVTVYESLLYSAWLRLPSEVDSEARKMFVEEVMELVELTSLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLM 1071          

HSP 2 Score: 101.679 bits (252), Expect = 3.705e-21
Identity = 67/252 (26.59%), Postives = 126/252 (50.00%), Query Frame = 1
Query:   10 NYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYS----------------------AWLRLSSDVDTKKRKIFV--------DEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD-TGRTVVCTIHQPSIDIFEAFDELLLM 669
            N  +D+ + M+    G+  + +LH +SG  RPG ++ L+G  G+GKT+L+  LAG+      + G +  +G+   +    R S Y  Q D+H   +T+ E+L +S                      A ++   D+D   + I V        D +++++ L+   D +VG   + G+S  Q+KR+T    LV     +FMDE ++GLD+     ++ ++R +V   G T +  + QP+ + ++ FD+++L+
Sbjct:  148 NKIMDVLSAMRIVSSGKRPISILHDISGIIRPGRMSLLLGPPGSGKTSLLLALAGKLDSTLKVSGRVTYNGHDMDEFVPQRTSAYIGQHDLHIGEMTVRETLAFSARCQGVGTRYDMLTELSRREKEASIKPDPDIDVYMKAISVEGQESVVTDYILKILGLEICADTMVGDAMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSLRQSVHILGGTALIALLQPAPETYDLFDDIVLL 399          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: PDR2_ORYSJ (Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 2.861e-106
Identity = 194/223 (87.00%), Postives = 205/223 (91.93%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            D + Y VDMP EMK  G+ EDRL+LL  VSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG+I ISGYPKKQETFARVSGYCEQ DIHSP VT+ ESLL+SAWLRL  DVD+  RK+F++EVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDEL LM
Sbjct:  870 DNIKYSVDMPQEMKAHGIVEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQNDIHSPQVTVSESLLFSAWLRLPKDVDSNTRKMFIEEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLM 1092          

HSP 2 Score: 97.4413 bits (241), Expect = 6.987e-20
Identity = 64/234 (27.35%), Postives = 117/234 (50.00%), Query Frame = 1
Query:   67 LQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAW----------------------LRLSSDVDT---------KKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD-TGRTVVCTIHQPSIDIFEAFDELLLM 669
            + +LH VSG  +P  +T L+G  G+GKTTL+  LAGR        G +  +G+  +     R + Y  Q D+H   +T+ E+L +SA                       ++  +D+D          ++  +  D +++++ L    D +VG   V G+S  QRKR+T    LV   + +FMDE ++GLD+     +++++R  +   G T V ++ QP+ + ++ FD+++L+
Sbjct:  186 MPILHDVSGIVKPRRMTLLLGPPGSGKTTLLLALAGRLGKDIKFSGQVTYNGHQMEDFVPQRTAAYISQHDLHIGEMTVRETLSFSARCQGVGSRFDMLTELSRREKAANIKPDADIDAFMKASAMEGQETNLITDYILKILGLDICADTMVGDDMVRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTTFQIVKSLRQAIHILGGTAVISLLQPAPETYDLFDDIILL 419          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: PDR2_NICPL (Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 2.861e-106
Identity = 194/223 (87.00%), Postives = 208/223 (93.27%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            + +NYYVDMPAEMKT+GV E+RLQLL   SGAFRPG+LTAL+GVSGAGKTTLMDVLAGRKTGGYIEG I ISGYPK Q TFARVSGYCEQ DIHSP+VT+YESLLYSAWLRL+SDV T+ RK+FV+EVMELVELK LR+ALVGLPGV+GLSTEQRKRLT AVELVANPSIIFMDEPTSGLDARAAAIVMRTVR TVDTGRTVVCTIHQPSIDIFEAFDELLLM
Sbjct:  862 NHVNYYVDMPAEMKTQGVEEERLQLLRDASGAFRPGILTALVGVSGAGKTTLMDVLAGRKTGGYIEGSINISGYPKNQTTFARVSGYCEQNDIHSPYVTVYESLLYSAWLRLASDVKTETRKMFVEEVMELVELKLLRNALVGLPGVDGLSTEQRKRLTTAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRKTVDTGRTVVCTIHQPSIDIFEAFDELLLM 1084          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: PDR3_ORYSJ (Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 3.737e-106
Identity = 193/223 (86.55%), Postives = 205/223 (91.93%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            D + Y VDMP EMK +GV +DRL+LL  VSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG I ISGYPKKQETFARVSGYCEQ DIHSP VT+YESLL+SAWLRL  DVD+  RK+F++EVMELVELK LRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFEAFDEL LM
Sbjct:  863 DNVRYSVDMPQEMKAQGVADDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSINISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNTRKMFIEEVMELVELKSLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLM 1085          

HSP 2 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 65/234 (27.78%), Postives = 117/234 (50.00%), Query Frame = 1
Query:   67 LQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAW----------------------LRLSSDVDT---------KKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD-TGRTVVCTIHQPSIDIFEAFDELLLM 669
            + +LH VSG  +P  +T L+G  G+GKTTL+  LAGR        G +  +G+  ++    R + Y  Q D+H   +T+ E+L +SA                       ++  +D+D          ++  +  D +++++ L+   D +VG   + G+S  QRKR+T    LV     +FMDE ++GLD+     ++ ++R TV   G T V ++ QP+ + +  FD+++L+
Sbjct:  177 MPVLHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLGKDLKASGKVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRFDMLTELSRREKAANIKPDADIDAFMKAAAMGGQEANVNTDYILKILGLEICADTMVGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQTVHILGGTAVISLLQPAPETYNLFDDIILL 410          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: PDR3_ORYSI (Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 3.737e-106
Identity = 193/223 (86.55%), Postives = 205/223 (91.93%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            D + Y VDMP EMK +GV +DRL+LL  VSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG I ISGYPKKQETFARVSGYCEQ DIHSP VT+YESLL+SAWLRL  DVD+  RK+F++EVMELVELK LRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFEAFDEL LM
Sbjct:  863 DNVRYSVDMPQEMKAQGVADDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSINISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNTRKMFIEEVMELVELKSLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLM 1085          

HSP 2 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 65/234 (27.78%), Postives = 117/234 (50.00%), Query Frame = 1
Query:   67 LQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAW----------------------LRLSSDVDT---------KKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD-TGRTVVCTIHQPSIDIFEAFDELLLM 669
            + +LH VSG  +P  +T L+G  G+GKTTL+  LAGR        G +  +G+  ++    R + Y  Q D+H   +T+ E+L +SA                       ++  +D+D          ++  +  D +++++ L+   D +VG   + G+S  QRKR+T    LV     +FMDE ++GLD+     ++ ++R TV   G T V ++ QP+ + +  FD+++L+
Sbjct:  177 MPVLHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLGKDLKASGKVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRFDMLTELSRREKAANIKPDADIDAFMKAAAMGGQEANVNTDYILKILGLEICADTMVGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQTVHILGGTAVISLLQPAPETYNLFDDIILL 410          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: PDR5_ORYSJ (Pleiotropic drug resistance protein 5 OS=Oryza sativa subsp. japonica GN=PDR5 PE=2 SV=2)

HSP 1 Score: 380.948 bits (977), Expect = 3.164e-105
Identity = 190/223 (85.20%), Postives = 208/223 (93.27%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            + MNYYVDMPAEMK +G  E RLQLL  +SGAFRPGVLTAL+GVSGAGKTTLMDVLAGRKT G IEGDIK+SGYPKKQETFAR+SGYCEQTDIHSP++T+YES++YSAWLRLSS+VD   RK+FV+EVM LVEL  LRDALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFE+FDELLL+
Sbjct:  855 NHMNYYVDMPAEMKAQGFTESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGTIEGDIKLSGYPKKQETFARISGYCEQTDIHSPNLTVYESIVYSAWLRLSSEVDKNTRKVFVEEVMSLVELDVLRDALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFESFDELLLL 1077          

HSP 2 Score: 92.0485 bits (227), Expect = 2.935e-18
Identity = 62/235 (26.38%), Postives = 115/235 (48.94%), Query Frame = 1
Query:   64 RLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYS----------------------AWLRLSSDVDT---------KKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT-GRTVVCTIHQPSIDIFEAFDELLLM 669
            +L++L+ V+G  +P  +T L+G   +GK+TLM  L G+      + G+I   G+  K+    R S Y  Q D+H+P +T+ E+L +S                      A ++   ++D          K+  I  D V++ + L    D +VG   + G+S  Q+KR+T    L    + +FMDE ++GLD+ +   +++ +R        TV+ ++ QP  + +  FD+++L+
Sbjct:  183 KLKILNDVNGIIKPSRMTLLLGPPSSGKSTLMRALTGKPDKNLKVSGEITYCGHTFKEFYPERTSAYVSQHDLHNPEMTVRETLDFSRRCLGSGARYDMLSELTRRERNAGIKPDPEIDALMKATVVEGKQNNIVTDLVLKALGLDICADTIVGGAMIRGISGGQKKRVTTGEMLTGPATALFMDEISTGLDSSSTFQIVKYIRQVTHVMNATVMMSLLQPPPETYALFDDIVLI 417          
BLAST of FC931060 vs. ExPASy Swiss-Prot
Match: TUR2_SPIPO (Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 1.570e-104
Identity = 191/223 (85.65%), Postives = 202/223 (90.58%), Query Frame = 1
Query:    1 DQMNYYVDMPAEMKTEGVGEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYSAWLRLSSDVDTKKRKIFVDEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLM 669
            D + Y VDMP EMK  GV ED+L LL  VSGAFRPGVLTALMGVSG GKTTLMDVLAGRKTGGYIEGDI+ISGYPK QETFAR+SGYCEQ DIHSPHVT+YESLLYSAWLRL ++VD K+RK+FVDEVM+LVEL  LR +LVGLPGV GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIFEAFDEL LM
Sbjct:  846 DNVKYSVDMPQEMKDRGVTEDKLLLLKGVSGAFRPGVLTALMGVSGRGKTTLMDVLAGRKTGGYIEGDIRISGYPKNQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPAEVDEKQRKMFVDEVMDLVELNSLRGSLVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLM 1068          

HSP 2 Score: 98.9821 bits (245), Expect = 2.401e-20
Identity = 67/237 (28.27%), Postives = 118/237 (49.79%), Query Frame = 1
Query:   55 GEDRLQLLHSVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFARVSGYCEQTDIHSPHVTLYESLLYS----------------------AWLRLSSDVDTKKRKIFV--------DEVMELVELKPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD-TGRTVVCTIHQPSIDIFEAFDELLLM 669
            G+  + +LH VSG  +P  +T L+G  GAGKTTL+  LAG+      + G++  +G+   +    R S Y  Q D+H   +T+ E+L +S                      A ++   DVD   + + V        D +++++ L    D +VG   + G+S  Q+KR+T    LV     +FMDE ++GLD+     ++ ++R +V   G T +  + QP+ + ++ FD++LL+
Sbjct:  167 GKRPISILHDVSGIIKPCRMTLLLGPPGAGKTTLLLALAGKLDNTLKVTGNVTYNGHGMHEFVPQRTSAYISQHDVHIGEMTVRETLAFSSRCQGVGTRYEMLTELSRREKEANIKPDPDVDVYMKAVAVEGQESVVTDYILKILGLDICADTMVGDGMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTALIALLQPAPETYDLFDDILLL 403          
The following BLAST results are available for this feature:
BLAST of FC931060 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 208
Match NameE-valueIdentityDescription
AB34G_ARATH5.215e-10886.55ABC transporter G family member 34 OS=Arabidopsis ... [more]
PDR1_TOBAC8.895e-10888.34Pleiotropic drug resistance protein 1 OS=Nicotiana... [more]
AB39G_ARATH4.415e-10785.65ABC transporter G family member 39 OS=Arabidopsis ... [more]
PDR7_ORYSJ7.530e-10787.89Putative pleiotropic drug resistance protein 7 OS=... [more]
PDR2_ORYSJ2.861e-10687.00Probable pleiotropic drug resistance protein 2 OS=... [more]
PDR2_NICPL2.861e-10687.00Pleiotropic drug resistance protein 2 OS=Nicotiana... [more]
PDR3_ORYSJ3.737e-10686.55Pleiotropic drug resistance protein 3 OS=Oryza sat... [more]
PDR3_ORYSI3.737e-10686.55Pleiotropic drug resistance protein 3 OS=Oryza sat... [more]
PDR5_ORYSJ3.164e-10585.20Pleiotropic drug resistance protein 5 OS=Oryza sat... [more]
TUR2_SPIPO1.570e-10485.65Pleiotropic drug resistance protein TUR2 OS=Spirod... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A02EF PostHarvP1 Citrus clementina cDNA clone C34101A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931060 ID=FC931060|Name=FC931060|organism=Citrus clementina|type=EST|length=669bp
GACCAGATGAATTACTACGTCGATATGCCAGCAGAAATGAAAACTGAAGG
AGTTGGAGAAGATCGTCTTCAACTGTTACACAGTGTCAGTGGTGCATTCA
GACCAGGAGTACTGACAGCATTAATGGGTGTAAGTGGTGCAGGGAAGACA
ACTCTAATGGATGTATTGGCAGGAAGGAAGACCGGAGGATACATCGAAGG
AGACATTAAGATTTCTGGTTACCCCAAAAAACAAGAAACGTTTGCTCGTG
TCAGTGGTTATTGTGAACAGACTGACATTCATTCTCCTCATGTTACTCTC
TATGAATCTCTTCTCTACTCAGCATGGCTTCGTCTTTCTTCAGACGTCGA
TACAAAAAAACGAAAGATATTCGTTGATGAAGTTATGGAGTTGGTTGAGC
TTAAACCATTGAGGGATGCTTTGGTTGGCCTTCCAGGAGTAAATGGTCTT
TCAACAGAGCAAAGGAAGAGATTGACAATTGCTGTAGAATTGGTTGCTAA
CCCTTCAATCATCTTCATGGACGAGCCAACATCTGGCCTTGATGCTAGAG
CAGCTGCTATTGTCATGCGTACGGTTAGAAATACAGTGGATACAGGGAGA
ACGGTTGTGTGCACAATTCATCAGCCAAGCATAGACATTTTTGAAGCATT
TGATGAGCTTTTGTTAATG
back to top