FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH1_ARATH (Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 9.483e-86
Identity = 150/180 (83.33%), Postives = 162/180 (90.00%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+EKTG++PDP STDN EFQIVL+I
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_CATRO (Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 4.706e-85
Identity = 151/180 (83.89%), Postives = 161/180 (89.44%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQ+H              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K G LPDP+STDNAEFQIVLTI
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_TOBAC (Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.369e-84
Identity = 150/180 (83.33%), Postives = 158/180 (87.78%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTI
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_NICSY (Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.369e-84
Identity = 150/180 (83.33%), Postives = 158/180 (87.78%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTI
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MEDSA (Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.369e-84
Identity = 148/180 (82.22%), Postives = 160/180 (88.89%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+ + SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC+E+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE++EKTG+LPDP+STDNAE QIVLTI
Sbjct:    1 MALLVETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_LUPLU (Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=2 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 1.788e-84
Identity = 150/180 (83.33%), Postives = 160/180 (88.89%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA R+EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEIYEK+G+ PDP STDNAEF+IVL+I
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PHASS (Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 2.336e-84
Identity = 150/178 (84.27%), Postives = 158/178 (88.76%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            MAL V+K+ SGRE+KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ L+WG GGGPDLIVDDGGDATLLIHEGVKAEE YEK GK+PDPASTDNAEFQIVL
Sbjct:    1 MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVL 178          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MESCR (Adenosylhomocysteinase OS=Mesembryanthemum crystallinum GN=SAHH PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 6.796e-84
Identity = 148/178 (83.15%), Postives = 157/178 (88.20%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            MAL+V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWG GGGPDLIVDDGGDATLLIHEGVKAEE YEK G +PDP STDN EFQ+VL
Sbjct:    1 MALAVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVL 178          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PETCR (Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2)

HSP 1 Score: 309.301 bits (791), Expect = 1.159e-83
Identity = 147/180 (81.67%), Postives = 160/180 (88.89%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MALSV+K+A+GRE+KVKD+S ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQT VLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K+G +PDPASTDNAEFQIVL+I
Sbjct:    1 MALSVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_WHEAT (Adenosylhomocysteinase OS=Triticum aestivum GN=SAHH PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 2.855e-82
Identity = 145/180 (80.56%), Postives = 159/180 (88.33%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MALSV+K++SGRE+KVKDL QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFS+QDH              WKGETL+EYWWCTE+ LDWG GGGPDLIVDDGGDATLLIHEGVKAEE +EK+GK+PDP STDN EF+IVLTI
Sbjct:    1 MALSVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTI 180          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH1_ARATH9.483e-8683.33Adenosylhomocysteinase 1 OS=Arabidopsis thaliana G... [more]
SAHH_CATRO4.706e-8583.89Adenosylhomocysteinase OS=Catharanthus roseus GN=S... [more]
SAHH_TOBAC1.369e-8483.33Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAH... [more]
SAHH_NICSY1.369e-8483.33Adenosylhomocysteinase OS=Nicotiana sylvestris GN=... [more]
SAHH_MEDSA1.369e-8482.22Adenosylhomocysteinase OS=Medicago sativa GN=SAHH ... [more]
SAHH_LUPLU1.788e-8483.33Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH P... [more]
SAHH_PHASS2.336e-8484.27Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH... [more]
SAHH_MESCR6.796e-8483.15Adenosylhomocysteinase OS=Mesembryanthemum crystal... [more]
SAHH_PETCR1.159e-8381.67Adenosylhomocysteinase OS=Petroselinum crispum GN=... [more]
SAHH_WHEAT2.855e-8280.56Adenosylhomocysteinase OS=Triticum aestivum GN=SAH... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top