FC931071

Overview
NameFC931071
Unique NameFC931071
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length578
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931071 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.703e-13
Identity = 32/51 (62.75%), Postives = 39/51 (76.47%), Query Frame = 2
Query:  140 CRKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 292
            C KKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:   16 CVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
The following BLAST results are available for this feature:
BLAST of FC931071 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MT3_CARPA4.703e-1362.75Metallothionein-like protein type 3 OS=Carica papa... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101B02EF PostHarvP1 Citrus clementina cDNA clone C34101B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931071 ID=FC931071|Name=FC931071|organism=Citrus clementina|type=EST|length=578bp
GAAGTATAACGGAATTCATTCATCAATCAAGTGATACTGTGGTTGTGTTC
ATATCCTTGCATGGTTGTGGAGCTCAAATTTTTCGGAGCCTGGGGCAACC
TTTTACTGCTAAGCTCATGAACTATATATTTTATGCACTTGCAGGAAGAA
GGGAAGCAGCTATGCTGCTGACTTCGTCGAGACTGACTTGAGCTTTGTCA
GCACCGTTGTTGTCATGGACGTTCAGGCTGCTGAGGCTGAAGGTAACTGC
AAGTGCGGCCCCACCTGCGCTTGTGTGAACTGCACTTGTGGTAGTCACTA
ATAAGCAAACACATGCAGCAAAAAATAAGAAGCTGCAAGTGTGCCTAAAT
ATTGTGGGGGTTAAGAATAATGTAAGGGTGATTAAAAAAAAAAAGAAAAA
TTCTCTACTTCGTTTTTATGATGGTCTACTACTAGTGTGTGGAGTGATGT
GCGTGTTGTGTCACCCATCACTCGTAATGTTTTGTGTTTCCTTCTTCATA
ATCATGTAATATATGGCCATGGCCATGACCGTGGCCTTGTGTGGTTTAAT
TTTAATGTATTATTGTTAGTCTACAAAA
back to top