FC931072

Overview
NameFC931072
Unique NameFC931072
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length680
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15263 contig Ccv1_Contig15263:1..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_EUCGU (Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 9.287e-52
Identity = 107/205 (52.20%), Postives = 143/205 (69.76%), Query Frame = 2
Query:   86 EEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSS-----GERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            +EE+   AMQLA   VLPM  +AAI+L + EI+AKAG    LS  E+AAQL  QN +AP+MLDR+ RLL S+ VL C++ +      ERLYGL PV K+ V N+DGVS+     +  DK+ MESW  L+DAV+EGGIPFN+ +GM  FEY   +P FN+ +++ M +HSTI M++ILE Y+GF+ +E +VDVGGG G  LSMI +
Sbjct:   17 DEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPGEVAAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRNLPDGKVERLYGLAPVCKFLVKNEDGVSIAALNLMNQDKILMESWYYLKDAVLEGGIPFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVA 221          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_CATRO (Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.584e-51
Identity = 107/212 (50.47%), Postives = 144/212 (67.92%), Query Frame = 2
Query:   65 KQNNKYEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSSG-----ERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            K +   EEEE+   AM+LA   VLPM  ++AI+L + E+I K+G    +S  E+AAQL  QN  AP+MLDR+LRLL S+ VL C++        ERLY L PV K+   N+DGVS+   + +  DKV MESW  L+DAV+EGGIPFN+ +GM  FEY   +P FN+ +++ M NHSTI M++ILE Y+GFQ ++ +VDVGGG G TL+MI S
Sbjct:    9 KNSMTKEEEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSELAAQLPTQNPDAPVMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMNQDKVLMESWYHLKDAVLEGGIPFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTIIMKKILEIYQGFQGLKTVVDVGGGTGATLNMIVS 220          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.020e-51
Identity = 104/205 (50.73%), Postives = 142/205 (69.27%), Query Frame = 2
Query:   86 EEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSS-----GERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            EEE+   AM LA   VLPM  ++AI+L + E+IAKAG    +S  E+AAQL   N +AP+MLDR+LRLL ++ VL+C +++      ERLYGL PV K+   N DGVS+   + +  DKV MESW  L+DAV++GGIPFN+ +GM  FEY   +P FN+ +++ M NHSTI M++ILE Y GF+ ++ +VDVGGG G TL+MI S
Sbjct:    3 EEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSELAAQLPTHNPEAPIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILEVYRGFEGLKTVVDVGGGTGATLNMIIS 207          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.027e-50
Identity = 110/220 (50.00%), Postives = 148/220 (67.27%), Query Frame = 2
Query:   35 MRSLSEIQLPKQNNKYEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGKLSAP-EIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVS--SG---ERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            M S +E QL     +  ++E+   AMQLA   VLPMA ++A++L + EI+AK G   +P EIA++L  +N +AP+MLDR+LRLL S+ VL CS    SG   ER+YGL PV KY   N+DGVS+     +  DKV MESW  L+DA+++GGIPFN+ +GM  FEY   +P FN+ ++  M NHSTI M++ILE Y+GF+ +  LVDVGGG G TL MI S
Sbjct:    1 MGSTAETQLTPV--QVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGSPMSPTEIASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLMESWYHLKDAILDGGIPFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVS 218          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT2_OCIBA (Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.287e-50
Identity = 103/206 (50.00%), Postives = 141/206 (68.45%), Query Frame = 2
Query:   83 EEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSS-----GERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            +EEE++  AMQLA   VLPM  ++AI+L + E+I KAG    +S  E+AAQL   N +A +MLDR+LRLL S+ +LEC + +      +RLYGL PV K+   N+DGVS+     +  DKV MESW  L+DAV++GGIPFN+ +GM  FEY   +P FN+ +++ M NHSTI M++ILE Y GF  ++ +VDVGGG G TL+MI S
Sbjct:   13 DEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKAGAGAFVSPAELAAQLLTTNAEAHVMLDRILRLLTSYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNEDGVSMAPLALMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIIS 218          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_POPKI (Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 6.656e-50
Identity = 107/222 (48.20%), Postives = 144/222 (64.86%), Query Frame = 2
Query:   35 MRSLSEIQLPKQNNKYEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSS-----GERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            M S  E Q+     +  +EE++  AMQLA   VLPM  + AI+L + EI+AKAG    LS  EIA+ L  +N  AP+MLDR+LRLL S+ +L CS+        ERLYGL PV K+   N+DGVS+     +  DKV MESW  L+DA++EGGIPFN+ +GM  FEY   +P FN+ ++K M +HSTI M++ILE Y+GF+ +  LVDVGGG G  ++ I S
Sbjct:    1 MGSTGETQMTP--TQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEIASHLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILEGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVS 220          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_CAPAN (Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 6.656e-50
Identity = 101/211 (47.87%), Postives = 143/211 (67.77%), Query Frame = 2
Query:   68 QNNKYEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSS-----GERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            QN    E+E++  AMQLA   VLPM  ++A++L + EI+AKAG    +S  E+AAQL  +N +AP+MLDRMLRLL ++ VL C++ +      ERLY L PV K    N DGVS+   + +  DKV MESW  L DAV++GG+PFN+ +GM  FEY   +P FN+ +++ M +HST+ M++ILE Y+GF+ +  +VDVGGG G T++MI S
Sbjct:    6 QNLTQTEDEAFLFAMQLASASVLPMVLKSALELDLLEIMAKAGPGAAISPSELAAQLPTKNPEAPVMLDRMLRLLATYSVLNCTLRTLPDGRVERLYSLAPVCKLLTKNADGVSVAPLLLMNQDKVLMESWYHLTDAVLDGGVPFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTMTMKKILEDYKGFEGLNSIVDVGGGTGATVNMIVS 216          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.483e-49
Identity = 106/222 (47.75%), Postives = 144/222 (64.86%), Query Frame = 2
Query:   35 MRSLSEIQLPKQNNKYEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSS-----GERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            M S  E Q+     +  +EE++  AMQLA   VLPM  + AI+L + EI+AKAG    LS  EIA+ L  +N  AP+MLDR+LRLL S+ +L CS+        ERLYGL PV K+   N+DGVS+     +  DKV MESW  L+DA+++GGIPFN+ +GM  FEY   +P FN+ ++K M +HSTI M++ILE Y+GF+ +  LVDVGGG G  ++ I S
Sbjct:    1 MGSTGETQMTP--TQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEIASHLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILDGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVS 220          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.483e-49
Identity = 108/222 (48.65%), Postives = 146/222 (65.77%), Query Frame = 2
Query:   35 MRSLSEIQLPKQNNKYEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAG---KLSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSSGE-----RLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            M S  E Q+   +    +EE+   AMQLA   VLPM  ++A++L + EIIAKAG   ++S  EIA+QL   N  AP+MLDRMLRLL  + +L CSV + +     RLYGL  V+KY V N+DGVS+     +  DKV MESW  L+DAV++GGIPFN+ +GM  FEY   +P FN+ ++K M +HSTI M++ILE Y GF+ ++ LVDVGGG G  ++ I S
Sbjct:    1 MGSTGETQITPTH--ISDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEIASQLPTTNPDAPVMLDRMLRLLACYIILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVS 220          
BLAST of FC931072 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.303e-49
Identity = 102/206 (49.51%), Postives = 139/206 (67.48%), Query Frame = 2
Query:   83 EEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGK---LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSS-----GERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITS 676
            +EEE++  AMQLA   VLPM  ++AI+L + E+I K+G    +S  ++AAQL   N  A +MLDR+LRLL S+ +LEC + +      ERLYGL PV K+   N+DGVS+     +  DKV MESW  L DAV++GGIPFN+ +GM  FEY   +P FN+ +++ M NHSTI M++ILE Y GF  ++ +VDVGGG G TL+MI S
Sbjct:   13 DEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVDLAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDGVSMAPLTLMNQDKVLMESWYHLSDAVVDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVS 218          
The following BLAST results are available for this feature:
BLAST of FC931072 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
COMT1_EUCGU9.287e-5252.20Caffeic acid 3-O-methyltransferase OS=Eucalyptus g... [more]
COMT1_CATRO1.584e-5150.47Caffeic acid 3-O-methyltransferase OS=Catharanthus... [more]
COMT1_COFCA6.020e-5150.73Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]
OMT1_ARATH1.027e-5050.00Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
COMT2_OCIBA2.287e-5050.00Caffeic acid 3-O-methyltransferase 2 OS=Ocimum bas... [more]
COMT1_POPKI6.656e-5048.20Caffeic acid 3-O-methyltransferase 1 OS=Populus ki... [more]
COMT1_CAPAN6.656e-5047.87Caffeic acid 3-O-methyltransferase OS=Capsicum ann... [more]
COMT1_POPTM1.483e-4947.75Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]
COMT1_MEDSA1.483e-4948.65Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_OCIBA3.303e-4949.51Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B03EF PostHarvP1 Citrus clementina cDNA clone C34101B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931072 ID=FC931072|Name=FC931072|organism=Citrus clementina|type=EST|length=680bp
AAAAAAGGAGGGAAAAAAAAAACTATAAGAAACAATGCGTTCGTTGTCGG
AAATACAGTTACCCAAACAGAATAATAAATATGAAGAAGAAGAGAGCTAT
TCACATGCCATGCAGCTAGCAATGGGCGTAGTGCTGCCCATGGCAACCCA
GGCAGCTATTCAGCTTGGCGTTTTTGAAATCATAGCCAAAGCTGGCAAAC
TCTCGGCTCCAGAGATTGCAGCACAGTTACAAGCGCAAAACGTAAAAGCA
CCAATGATGCTAGACAGAATGCTCAGGCTTCTGGTCAGCCACCGTGTGCT
TGAGTGCTCTGTTTCTAGTGGCGAGAGGCTATATGGTCTCACCCCCGTGT
CCAAATATTTTGTTAGTAATAAAGATGGTGTTTCGTTGGGTCACTTTATG
GCCTTGCCTCTCGACAAGGTCTTCATGGAGAGTTGGTTGGGATTGAGAGA
TGCAGTTATGGAGGGAGGAATACCATTCAATAGGGTGCATGGAATGCACA
TCTTTGAGTACGCTTCCGGAAACCCCGGGTTTAATGAAACTTATCACAAG
GCAATGTTCAACCACTCAACCATAGCCATGGAGAGAATCCTGGAACATTA
CGAGGGCTTTCAGAACGTTGAGCGACTCGTCGATGTTGGAGGAGGCTTTG
GTGTCACCCTCAGTATGATTACTTCCAATA
back to top