FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_SUASA (S-adenosylmethionine synthetase 2 OS=Suaeda salsa GN=METK2 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 5.162e-62
Identity = 112/119 (94.12%), Postives = 118/119 (99.16%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ME+FLFTSESVNEGHPDKLCD+VSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKAN+DYEKIVRDTCRSIGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPE++G
Sbjct:    1 MESFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEDVG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LITCN (S-adenosylmethionine synthetase OS=Litchi chinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.805e-62
Identity = 113/119 (94.96%), Postives = 118/119 (99.16%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDAVLDACLAQDPDSKVACETCT+TNMVMVFGEITTKANVDYE+IVRDTCRSIGFTS DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTRTNMVMVFGEITTKANVDYEQIVRDTCRSIGFTSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_TOBAC (S-adenosylmethionine synthetase 2 OS=Nicotiana tabacum GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.805e-62
Identity = 112/119 (94.12%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_PETHY (S-adenosylmethionine synthetase 1 OS=Petunia hybrida GN=SAM1 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.805e-62
Identity = 112/119 (94.12%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_BETVU (S-adenosylmethionine synthetase 2 OS=Beta vulgaris GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.502e-61
Identity = 114/119 (95.80%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDAVLDACLAQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGFTS DVGLDAD CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKAEVDYEKIVRDTCRSIGFTSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_ORYSJ (S-adenosylmethionine synthetase 1 OS=Oryza sativa subsp. japonica GN=SAM1 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.502e-61
Identity = 111/119 (93.28%), Postives = 117/119 (98.32%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD+VSDAVLDACLA+DPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVR+TCR+IGF SADVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    4 LDTFLFTSESVNEGHPDKLCDQVSDAVLDACLAEDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRETCRNIGFVSADVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 122          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_ORYSI (S-adenosylmethionine synthetase 1 OS=Oryza sativa subsp. indica GN=SAM1 PE=2 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 1.502e-61
Identity = 111/119 (93.28%), Postives = 117/119 (98.32%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD+VSDAVLDACLA+DPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVR+TCR+IGF SADVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    4 LDTFLFTSESVNEGHPDKLCDQVSDAVLDACLAEDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRETCRNIGFVSADVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 122          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK4_POPTR (S-adenosylmethionine synthetase 4 OS=Populus trichocarpa GN=METK4 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.962e-61
Identity = 111/119 (93.28%), Postives = 118/119 (99.16%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFLFTSESVNEGHPDKLCD+VSDA+LDACLAQDP+SKVACETC+KTNMVMVFGEITTKANVDYEKIVRDTCR IGFTSADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLAQDPESKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK4_HORVU (S-adenosylmethionine synthetase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.562e-61
Identity = 111/119 (93.28%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +ETFLFTSESVNEGHPDKLCD++SDAVLDACLA+DPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    4 VETFLFTSESVNEGHPDKLCDQISDAVLDACLAEDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 122          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK5_VITVI (S-adenosylmethionine synthetase 5 OS=Vitis vinifera GN=METK5 PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 3.346e-61
Identity = 111/119 (93.28%), Postives = 117/119 (98.32%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA++DYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADIDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_SUASA5.162e-6294.12S-adenosylmethionine synthetase 2 OS=Suaeda salsa ... [more]
METK_LITCN8.805e-6294.96S-adenosylmethionine synthetase OS=Litchi chinensi... [more]
METK2_TOBAC8.805e-6294.12S-adenosylmethionine synthetase 2 OS=Nicotiana tab... [more]
METK1_PETHY8.805e-6294.12S-adenosylmethionine synthetase 1 OS=Petunia hybri... [more]
METK2_BETVU1.502e-6195.80S-adenosylmethionine synthetase 2 OS=Beta vulgaris... [more]
METK1_ORYSJ1.502e-6193.28S-adenosylmethionine synthetase 1 OS=Oryza sativa ... [more]
METK1_ORYSI1.502e-6193.28S-adenosylmethionine synthetase 1 OS=Oryza sativa ... [more]
METK4_POPTR1.962e-6193.28S-adenosylmethionine synthetase 4 OS=Populus trich... [more]
METK4_HORVU2.562e-6193.28S-adenosylmethionine synthetase 4 OS=Hordeum vulga... [more]
METK5_VITVI3.346e-6193.28S-adenosylmethionine synthetase 5 OS=Vitis vinifer... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top