FC931076

Overview
NameFC931076
Unique NameFC931076
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931076_ssr18 microsatellite FC931076_ssr18:18..33. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14439 contig Ccv1_Contig14439:7..710. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. japonica GN=SAP8 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.431e-59
Identity = 110/168 (65.48%), Postives = 130/168 (77.38%), Query Frame = 3
Query:  207 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            M+H ETGCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++KQ+QAKLAASSI SIVN     +G E + A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI K+NPV+KA
Sbjct:    1 MEHKETGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVN--GGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKA 165          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSI (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. indica GN=SAP8 PE=2 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 6.431e-59
Identity = 110/168 (65.48%), Postives = 130/168 (77.38%), Query Frame = 3
Query:  207 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            M+H ETGCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++KQ+QAKLAASSI SIVN     +G E + A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI K+NPV+KA
Sbjct:    1 MEHKETGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVN--GGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKA 165          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP4_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Oryza sativa subsp. japonica GN=SAP4 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.027e-56
Identity = 105/168 (62.50%), Postives = 126/168 (75.00%), Query Frame = 3
Query:  207 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            M+H E GCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++K++QAKLAASSI SIVN           A+ +  V  + VE K + VQP+  +  SE V   PK  EGP+RC++C+KRVGLTGF CRCGN+YC  HRYSDKH C FDYRTAARDAI K+NPV+KA
Sbjct:    1 MEHKEAGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVAASGSTAVAVAQVEAKTLVVQPTDVAGTSEEVAVVPKVKEGPNRCATCRKRVGLTGFNCRCGNMYCALHRYSDKHECQFDYRTAARDAIAKANPVVKA 167          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP2_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 2 OS=Arabidopsis thaliana GN=SAP2 PE=2 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 1.388e-53
Identity = 101/172 (58.72%), Postives = 129/172 (75.00%), Query Frame = 3
Query:  207 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNG--SESVAAATVDVQASSVEPKIISVQPSCASELSESVE----AKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            MDHD+TGCQ+PPEGP LC NNCGFFGS ATMNMCSKC+KD++ +Q+Q    AS++      TSSS+    E+  AA VD++  SVEP  +SVQPS    ++E V     AKPK GPSRC++C KRVGLTGFKCRCG+L+C +HRY+D H+C F+Y  AA++AI K+NPV+KA
Sbjct:    1 MDHDKTGCQSPPEGPKLCTNNCGFFGSAATMNMCSKCHKDMLFQQEQGAKFASAVSG----TSSSSNIIKETFTAALVDIETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPK-GPSRCTTCNKRVGLTGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANPVVKA 167          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP6_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Arabidopsis thaliana GN=SAP6 PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 7.916e-33
Identity = 75/171 (43.86%), Postives = 108/171 (63.16%), Query Frame = 3
Query:  216 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSE--------SVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            +E  CQ P E   LC+NNCGF GS ATMN+CS CY D+ LKQ Q    +SSI S V E+S S    S +++ +   +S + P ++   PS   E+ E        + E   ++ P+RC++C+KRVGLTGFKCRCG ++C  HRY + H C +D+++A R+ I K+NP++KA
Sbjct:    3 EEHRCQTP-ESNRLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQ---SSSIKSTV-ESSLSVSPPSSSSSEI---SSPIIPPLLK-NPSVKLEVPEKKAVISLPTTEQNQQQRPNRCTTCRKRVGLTGFKCRCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANPLVKA 164          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP7_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Arabidopsis thaliana GN=SAP7 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.350e-32
Identity = 63/159 (39.62%), Postives = 102/159 (64.15%), Query Frame = 3
Query:  237 PPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSC---ASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            PP  P LC N CGFFGS + MN+CSKCY+ +  ++DQ  +A +++ + +   S S  +       ++++ + +E  +++ +PS    A+E  E+  ++P    +RC SC K+VG+ GFKC+CG+ +C SHRY +KH C FD++   RDAI K+NP++KA
Sbjct:   12 PPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVKNSLKLPSCSIIAPG-QKHPLEIKPAHLETVVVTAEPSSVPVAAEQDEAEPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVKA 169          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP9_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Oryza sativa subsp. japonica GN=SAP9 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.131e-32
Identity = 69/155 (44.52%), Postives = 93/155 (60.00%), Query Frame = 3
Query:  240 PEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            PE PILC+NNCGFFGS  T NMCSKCY+D +       +AA  +       +SS+ +    A   +V A++VE K  + +P             PK   +RC SC+K+VGLTGF+CRCG  +C +HRY++ H+C FDY+ A RD I K NPV+ A
Sbjct:   17 PEAPILCVNNCGFFGSSMTNNMCSKCYRDFV---KVTTMAAPVVEKKAFTPASSSKTPLEPAKPDEVPAAAVEDKQAAQEP-------------PKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNPVVIA 155          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP4_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Arabidopsis thaliana GN=SAP4 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.131e-32
Identity = 67/163 (41.10%), Postives = 94/163 (57.67%), Query Frame = 3
Query:  216 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            +E  C+ P EG  LC+NNCGFFGS ATMN+CS CY D+ LKQ Q     S++ S ++   +       A   +     + E K I +            +  P + P+RC+ C+KRVGLTGF CRCG  +C SHRY + H C FD+++A R+ I K+NP++ A
Sbjct:    3 EEHRCETP-EGHRLCVNNCGFFGSSATMNLCSNCYGDLCLKQQQQASMKSTVESSLSPVIAPVLENYAAELEIPTTKKTEEKKPIQIPTE---------QPSPPQRPNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAGREEIAKANPLVIA 155          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP6_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Oryza sativa subsp. japonica GN=SAP6 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.673e-31
Identity = 69/163 (42.33%), Postives = 90/163 (55.21%), Query Frame = 3
Query:  216 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            +ETG   P E PILC+NNCGFFGS  T NMCSKCY+D +         A ++ ++V +   ++ S +     V    S           S A       E  PK   +RC SC+K+VGLTGFKCRCG  +C  HRY+D H C FDY+   R+ I K NP++KA
Sbjct:   11 EETGVHTP-EAPILCVNNCGFFGSRMTENMCSKCYRDTV--------KAKTVATVVEKKPLASLSSTPLVTEVTDGGSG----------SVADGKQVMEEDTPKPPSNRCLSCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQVGREQIAKQNPLVKA 154          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP1_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Arabidopsis thaliana GN=SAP1 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 9.677e-31
Identity = 63/155 (40.65%), Postives = 87/155 (56.13%), Query Frame = 3
Query:  240 PEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            P  P LC+  CGFFGS + MN+CSKCY+DI   ++Q   A +++   +N        +     T  V  S           S A+ L       PK   +RC SC K+VG+TGFKCRCG+ +C +HRY + H C FD++  AR+AI K+NPV+KA
Sbjct:   13 PSEPKLCVKGCGFFGSPSNMNLCSKCYRDIRATEEQTASAKAAVEKSLNPNKPKTQPQQSQEITQGVLGSGSSSSSTRGGDSAAAPLDP-----PKSTATRCLSCNKKVGVTGFKCRCGSTFCGTHRYPESHECQFDFKGVAREAIAKANPVVKA 162          
The following BLAST results are available for this feature:
BLAST of FC931076 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
SAP8_ORYSJ6.431e-5965.48Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP8_ORYSI6.431e-5965.48Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ORYSJ1.027e-5662.50Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP2_ARATH1.388e-5358.72Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP6_ARATH7.916e-3343.86Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP7_ARATH1.350e-3239.62Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP9_ORYSJ5.131e-3244.52Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ARATH5.131e-3241.10Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP6_ORYSJ5.673e-3142.33Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP1_ARATH9.677e-3140.65Zinc finger A20 and AN1 domain-containing stress-a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B08EF PostHarvP1 Citrus clementina cDNA clone C34101B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931076 ID=FC931076|Name=FC931076|organism=Citrus clementina|type=EST|length=704bp
TTTTTAAAAAAAATCACAGAGAGAGAGAGAGAGACACCCGGAAAGGGAAA
CGAGGACGTCTCTCATCGGTTTTTGCCTGCTCTCTCCCCGATAGGCCGAT
CTGGTCCATTTAATTTTAGGGGCTCATTGGATGCTGGCTTGAGCTCGGGG
ATCGGCTTAAGGGATTCATTGCTGTTTCTTCTGTTGCTCGCAGGGGTGGT
GAAAACATGGACCATGATGAGACTGGATGCCAAGCTCCTCCTGAGGGCCC
TATCTTGTGCATCAACAATTGTGGTTTCTTTGGAAGTGTGGCTACTATGA
ATATGTGTTCCAAATGCTACAAGGATATAATGCTGAAACAGGATCAAGCT
AAGCTTGCTGCTTCATCTATTGGAAGCATTGTGAATGAAACGTCAAGCAG
CAATGGAAGTGAATCTGTTGCTGCTGCCACTGTTGATGTGCAAGCTAGTT
CAGTGGAGCCAAAAATCATCTCTGTGCAGCCATCATGTGCTTCAGAATTG
AGCGAGAGTGTGGAGGCAAAGCCGAAGGAGGGTCCCAGCCGGTGCAGCAG
TTGCAAGAAGCGTGTTGGTTTAACAGGATTCAAATGTCGCTGTGGTAACT
TATACTGTGTGTCACATCGCTATTCGGACAAACATAACTGCCCCTTTGAC
TACCGCACTGCTGCTAGGGATGCTATAATTAAAAGCAACCCTGTGATCAA
GGCT
back to top