FC931080

Overview
NameFC931080
Unique NameFC931080
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15268 contig Ccv1_Contig15268:1..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931080 vs. ExPASy Swiss-Prot
Match: OXA1_ARATH (Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana GN=OXA1 PE=2 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 1.843e-37
Identity = 85/196 (43.37%), Postives = 122/196 (62.24%), Query Frame = 1
Query:  112 MAYRRSLTTRATLIARAYNPSFNYIIYDHDHKQKSPDETLSRTNIHSFIQSRSFGSSLNNSYGLGNFFHSQRVSQFSLVPSVGSAFCRYMSTTVGEGADKIELISDVADVFTETTVQAI-ANQXXXXXXXXXXXXDSFLPVAALQHFIDAMHNFTGFNWWASIIVTTLLIRTATVPLLINQLKSTSKLTLMRPRLE 696
            MA+R++L+ R+ L AR   P ++ I  + DH++ S  +  S+ + HSF+  RS  +S  +    G+           L P+ G AF RYMS+  G G++KI ++SD+A+V T++T+Q + A              DSF P+AALQ  ID +H FTGF WWASI+V T+LIR++TVPLLI Q+K T+KL LMRPRLE
Sbjct:    1 MAFRQTLSIRSRLFARRNQPVYHIIPRESDHERDSFCQETSQRSYHSFLHQRSVNNSDFSKVSGGSL-------HLPLAPTSGFAFYRYMSSAPGVGSEKIGVMSDIAEVITDSTLQDVPAQAAAAVSEVTLAAADSFFPIAALQQCIDMVHTFTGFEWWASIVVATILIRSSTVPLLIKQMKDTTKLALMRPRLE 189          
BLAST of FC931080 vs. ExPASy Swiss-Prot
Match: OXA1L_ARATH (Mitochondrial inner membrane protein OXA1-like OS=Arabidopsis thaliana GN=OXA1L PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.912e-26
Identity = 75/198 (37.88%), Postives = 109/198 (55.05%), Query Frame = 1
Query:  124 RSLTTRATLIARAYNPSFNYIIYDHDHKQKSPDETLSRTNIHSFIQSRSFGSSLNNSYGLGNFFHSQRVSQFSLVP-SVGSAFCRYMSTTVGEGADKIELISDVA-DVFTETTVQAIANQXXXXXXXXXXXX----DSFLPVAALQHFIDAMHNFTGFNWWASIIVTTLLIRTATVPLLINQLKSTSKLTLMRPRLEE 699
            R +T R  L+ R   PS  ++I D   + KS     S T I   +       + N +  L + F  +    F+  P  +G + CR+MS+T  E +DK++ I  VA +V  +  ++A+                   DS  PVAALQH IDA+H+FTG NWWASI +TT+LIR  T+P+L+NQLK+T KL ++RP+LEE
Sbjct:    6 RGITKRVNLLQRRVYPSCGHLIRDDRDETKSGS---SDTMIREVL-------ARNGTNKLSSMFADRHYQSFATGPLGLGLSSCRHMSSTPPEWSDKVDGIDFVATEVVPDEIIEAVTTTSQAVVPAINEVAIAAADSAFPVAALQHLIDAVHSFTGLNWWASIALTTVLIRGVTIPILLNQLKATYKLNVLRPQLEE 193          
The following BLAST results are available for this feature:
BLAST of FC931080 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
OXA1_ARATH1.843e-3743.37Mitochondrial inner membrane protein OXA1 OS=Arabi... [more]
OXA1L_ARATH1.912e-2637.88Mitochondrial inner membrane protein OXA1-like OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101B12EF PostHarvP1 Citrus clementina cDNA clone C34101B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931080 ID=FC931080|Name=FC931080|organism=Citrus clementina|type=EST|length=713bp
GACTCGAGCCTCTTCGTCTTCCGTCAGCACCAGATACTTCCCAGTACTAC
TTCACCTCAGCAACTTCTACTGACACGTTTCCGTTACCTGAGCCCGTAGA
TTCTCGTAACAATGGCTTATCGGCGAAGCCTGACTACGAGAGCAACCCTT
ATTGCTCGAGCTTATAATCCATCATTTAACTACATTATCTACGACCACGA
TCATAAACAAAAATCTCCTGATGAAACTTTGTCTCGAACTAATATCCATA
GCTTCATCCAATCGAGGTCGTTTGGAAGCAGTTTAAATAATTCGTATGGG
TTGGGTAATTTCTTCCACAGTCAAAGGGTTTCACAGTTCTCTCTCGTTCC
GAGTGTGGGTTCTGCTTTTTGTCGGTATATGTCAACTACGGTTGGAGAAG
GAGCAGATAAGATAGAATTGATCAGCGATGTGGCTGATGTTTTCACGGAG
ACGACAGTGCAAGCTATTGCTAACCAAGCTCCAGCTGTGAATGAGGTTGC
CATTGCTGCTGCTGATTCTTTCTTGCCTGTTGCAGCTCTACAGCATTTTA
TTGATGCAATGCATAATTTTACCGGCTTTAATTGGTGGGCTTCCATAATT
GTGACAACTCTTTTGATTCGGACAGCAACTGTTCCACTTTTGATCAATCA
ACTCAAATCAACTTCAAAATTGACCTTAATGAGACCGCGCTTGGAGGAAA
AATCAGCAGATAT
back to top