FC931084

Overview
NameFC931084
Unique NameFC931084
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5545 contig Ccv1_Contig5545:888..1578. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931084 vs. ExPASy Swiss-Prot
Match: MOS2_ARATH (Protein MOS2 OS=Arabidopsis thaliana GN=MOS2 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.477e-41
Identity = 77/108 (71.30%), Postives = 97/108 (89.81%), Query Frame = 2
Query:    2 KELRSGRLYLKKGEVVDVVGPTMCDISMDESGELIQGVDQDLLETALPRRGGPVLVLYGRHKGVYGNLVDRDLDRETGVVRDADTHELVNVKLEQIAEYIGDPSYLGY 325
            K+ + GRLYLKKG+VVDVVGPT CDI+MDE+ EL+QGVDQ+LLETALPRRGGPVLVL G+HKGVYGNLV++DLD+ETGVVRD D H++++V+L+Q+AEY+GD   + Y
Sbjct:  355 KDWKGGRLYLKKGKVVDVVGPTTCDITMDETQELVQGVDQELLETALPRRGGPVLVLSGKHKGVYGNLVEKDLDKETGVVRDLDNHKMLDVRLDQVAEYMGDMDDIEY 462          
The following BLAST results are available for this feature:
BLAST of FC931084 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MOS2_ARATH4.477e-4171.30Protein MOS2 OS=Arabidopsis thaliana GN=MOS2 PE=2 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101C04EF PostHarvP1 Citrus clementina cDNA clone C34101C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931084 ID=FC931084|Name=FC931084|organism=Citrus clementina|type=EST|length=691bp
CAAGGAACTTAGAAGTGGGAGATTGTATTTGAAGAAAGGAGAGGTTGTGG
ATGTAGTTGGGCCGACCATGTGTGATATATCAATGGATGAGAGTGGGGAG
TTGATTCAAGGAGTCGATCAGGATCTTCTTGAGACTGCATTGCCCAGACG
TGGGGGCCCGGTTCTTGTTCTGTACGGGAGGCATAAGGGTGTATATGGGA
ATTTAGTTGATCGGGATTTGGATAGAGAGACTGGTGTTGTTCGTGATGCT
GATACCCACGAGTTGGTTAATGTTAAGCTTGAGCAGATTGCAGAGTATAT
TGGGGATCCCAGCTATCTTGGTTATTGATTATCTTGCATCAAAAGGTATC
GTGAGCATTGCTCATACTTGTTGAGCTACAGTGAGTGTTGCTGGTTGTCT
AGGCAAGGTGCTTGGATATTGCTTATCCATACAGACCCGCTTCATGTTCT
TGTTTTATTGGCAATGGCATAAAGCTTCCACTTCCGGCTCAAAGTTATGG
GGAGGTTATGGGGAGCGAGTCCCATGCCTGTACATTGCTTACGGACATAA
GACAGTGTGAGAATGCAACATTGATTACCCATATGAGCATCAAAATGTGA
ACTAGTGCATTGGCTGTCTGTAGACTGTTCAAGGTCTCTGTGGCTCATTG
TACCAGGCACTCGGGCTTTAAACTTATAGCAGTCGTTTGAT
back to top