FC931085

Overview
NameFC931085
Unique NameFC931085
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length683
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15269 contig Ccv1_Contig15269:1..683. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931085 vs. ExPASy Swiss-Prot
Match: AGL19_ARATH (Agamous-like MADS-box protein AGL19 OS=Arabidopsis thaliana GN=AGL19 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.704e-11
Identity = 44/168 (26.19%), Postives = 85/168 (50.60%), Query Frame = 1
Query:   82 KLEPIKHEKARLATFKKRKNSLLKKAYEFATLCDVEVCIIIYGPRVKGQSLKPKIWTSKEGQLTSIIRKYKKKISAVDHGQQRT-LSLAKFDESK--TRQVDDAATMARKKICVGDFTTWDQGMDSFSEDQLKMILSTMDDKLKAADGKLNMIKGDQNLKNKAASRKL 576
            +++ I++  +R  TF KR+N LLKKA+E + LCD EV ++I+ PR        K++      + + I +Y+++I  + +  +R   S    DE+   T++++      RK +         +G+D+ S ++L+ + + +D  L     K   +  ++  K KA  R L
Sbjct:    7 EMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPR-------SKLYEFSSSSIAATIERYQRRIKEIGNNHKRNDNSQQARDETSGLTKKIEQLEISKRKLL--------GEGIDACSIEELQQLENQLDRSLSRIRAKKYQLLREEIEKLKAEERNL 159          
The following BLAST results are available for this feature:
BLAST of FC931085 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
AGL19_ARATH4.704e-1126.19Agamous-like MADS-box protein AGL19 OS=Arabidopsis... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101C05EF PostHarvP1 Citrus clementina cDNA clone C34101C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931085 ID=FC931085|Name=FC931085|organism=Citrus clementina|type=EST|length=683bp
GTTTTCCAAAAAGAAACTGGGACTCAAACAAAGACGCACCAAGAAACTCT
TTTGGGATTAGTGATGGCTTGTGAAGCACTTAAATTGGAGCCAATAAAGC
ATGAGAAAGCTCGCTTGGCAACCTTTAAAAAGAGAAAGAACAGTTTGTTG
AAGAAGGCTTATGAGTTCGCAACTCTGTGCGATGTTGAAGTATGCATCAT
CATCTATGGTCCAAGAGTCAAAGGCCAGTCTTTGAAGCCGAAGATCTGGA
CCTCAAAGGAAGGTCAATTGACCAGTATTATCAGAAAGTACAAGAAGAAA
ATTAGTGCAGTTGATCACGGTCAGCAGAGAACGTTATCTTTGGCTAAATT
CGATGAAAGTAAGACGAGGCAAGTTGATGATGCAGCTACGATGGCTCGCA
AGAAAATCTGTGTAGGAGATTTTACTACATGGGATCAAGGTATGGACAGT
TTCTCAGAGGATCAACTGAAGATGATTCTTAGTACAATGGATGATAAGCT
CAAAGCTGCGGACGGGAAACTAAACATGATCAAAGGAGATCAGAACCTTA
AGAATAAGGCCGCATCAAGAAAGTTAGATCATGACCATTCAAATGATGCA
AAATCACTCGTCAATTCGCAGCCTGGTTACGAGGTTAGTCAAAAGCTGCC
ATCTGATTCAAGTTTCATGGAGATTCAATGCGG
back to top