FC931087

Overview
NameFC931087
Unique NameFC931087
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15270 contig Ccv1_Contig15270:1..721. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.023e-48
Identity = 98/222 (44.14%), Postives = 137/222 (61.71%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AVLD  I PF K +G  A+ Y+G  P  N +  K MS  S   M  +L+ Y GF+G+K LVDVGG  G  +  I+ K+P I +GINFDLP V+ +APS PGV H+GGDMF SIP ADA+FMKW+   W+D+ C   ++NCY+ALP  GK+I  E +LP   + S  T+ ++  D+ +M  +   GK RT++EF+ L   AGF   +     +   ++EF K
Sbjct:  145 DAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK 363          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 8.962e-48
Identity = 98/207 (47.34%), Postives = 133/207 (64.25%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLR 632
            +AVLD  I PF K +G  A+ Y+G  P  N +  + MS  S   M  +L+ Y GF+G+K +VDVGG  G  L MI+ K+P I +GINF+LP VV +APS  GV H+GGDMF S+P  DAIFMKW+   W+DD C+ +++NCY+ALP  GK+I  E VLP+  + S  T+ ++  D+ VM  +   GK RTE+EF+ L   AGF   R
Sbjct:  132 DAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILEVYRGFEGLKTVVDVGGGTGATLNMIISKYPTI-KGINFELPHVVEDAPSHSGVEHVGGDMFVSVPKGDAIFMKWICHDWSDDHCRKLLKNCYQALPDNGKVILAECVLPEAPDTSLATQNVVHVDV-VMLAHNPGGKERTEKEFEALAKGAGFKEFR 335          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_CAPAN (Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 1.997e-47
Identity = 97/222 (43.69%), Postives = 136/222 (61.26%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AVLD  + PF K +G  A+ Y+G  P  N +  + MS  S   M  +L+ Y GF+G+  +VDVGG  G  + MI+ K+P I +GINFDL  V+ +AP+ PGV H+G DMF S+P ADAIFMKW+   W+D+ C   ++NCY+ALPA GK++  E +LP+  + S  T+  +  DI VM  +   GK RTE+EF+ L   AGF   R     Y   ++EF K
Sbjct:  141 DAVLDGGV-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTMTMKKILEDYKGFEGLNSIVDVGGGTGATVNMIVSKYPSI-KGINFDLSHVIEDAPAYPGVEHVGRDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPANGKVLVAECILPETPDTSAATKNAVHVDI-VMLAHNPGGKERTEKEFEALAKGAGFTGFRRACCAYQTWVMEFHK 359          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_CAPCH (Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.406e-47
Identity = 96/222 (43.24%), Postives = 136/222 (61.26%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AVLD  + PF K +G   + Y+G  P  N +    MS  +   M  +L+ Y GF+G+  +VDVGG  G  + MI+ K+P I +GINFDLP V+ +APS PGV  +GGDMF S+P ADAIFMKW+   W+DD C  +++NCY+ALPA GK+I  E +LP+  + S  T++ + GDI +M  +   GK RTE++F+ L     F   R     Y   ++EF K
Sbjct:  141 DAVLDGGV-PFNKAYGMTTFEYHGTDPRFNKVFNCGMSDHTTLSMKKILEDYTGFEGLNSIVDVGGGTGATVNMIVSKYPSI-KGINFDLPHVIRDAPSYPGVEQVGGDMFVSVPKADAIFMKWICHDWSDDHCIKLLKNCYEALPANGKVIIVECILPEAPDTSAATKSKVHGDI-IMLAHNPGGKERTEKDFEALANWGWFSRFRKVCCAYHTWVMEFNK 359          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_MAIZE (Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.448e-47
Identity = 97/222 (43.69%), Postives = 132/222 (59.46%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AVLD  I PF K +G  A+ Y+G     N +  + M   SV     +LD Y GF+GV  LVDVGG  G  L  I  +HP I  G+NFDLP V++EAP  PGV H+GGDMF S+PA DAI MKW+L  W+D  C  +++NCY ALP  GK+I  E VLP ++  + + + +   D+ +M  +   GK R E+EF++L   AGF   +A Y+      +EF K
Sbjct:  146 DAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHI-SGVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK 364          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.809e-47
Identity = 97/222 (43.69%), Postives = 134/222 (60.36%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AV+D  I PF K +G  A+ Y+G  P  N +  + MS  S   M  +L+ Y GF G+K +VDVGG  G  L MI+ K+P I +GINFDLP V+ +APS PGV H+GGDMF S+P  DAIFMKW+   W+D+ C   ++NCY ALP  GK+I  E VLP+  +    T+ ++  D+ +M  +   GK RTE+EF+ L  +AGF         Y   ++E  K
Sbjct:  143 DAVVDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGLATKNVVHIDV-IMLAHNPGGKERTEKEFQGLAKAAGFKQFNKACCAYNTWIMELLK 361          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT2_OCIBA (Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.690e-46
Identity = 97/222 (43.69%), Postives = 133/222 (59.91%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AVLD  I PF K +G  A+ Y+G  P  N +  + MS  S   M  +L+ Y GF G+K +VDVGG  G  L MI+ K+P I +GINFDLP VV +APS PGV H+GGDMF S+P  DAIFMKW+   W+D  C   ++ CY+ALP  GK+I  E VLP+  +    T+ ++  D+ +M  +   GK RTE+EF+ L  ++GF         Y   ++E  K
Sbjct:  143 DAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIISKYPSI-KGINFDLPHVVEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDAHCVKFLKKCYEALPENGKVILAECVLPEAPDTGLATKNVVHIDV-IMLAHNPGGKERTEKEFQVLAKASGFKQFNKVCCAYNSWIMELLK 361          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.690e-46
Identity = 97/222 (43.69%), Postives = 135/222 (60.81%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AVLD  I PF K +G  A+ Y+G  P  N +  K M+  S   M  +L+ Y GF+G+  +VDVGG  G  + MI+ K+P I +GINFDLP V+ +AP  PGV H+GGDMF S+P  DAIFMKW+   W+D+ C   ++NCY ALP  GK+I  E +LP   + S  T+ ++  D+ VM  +   GK RTEQEF+ L   +GF  +R     +   ++EF K
Sbjct:  145 DAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDV-VMLAHNPGGKERTEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK 363          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.207e-46
Identity = 93/222 (41.89%), Postives = 137/222 (61.71%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +A+LD  I PF K +G  A+ Y+G  P  N +    MS  S   M  +L+ Y GF+G+  LVDVGG  G  L+MI+ K+P + +GINFDLP V+ +APS PG+ H+GGDMF S+P  DAIFMKW+   W+D+ C   ++NCY++LP  GK+I  E +LP+  + S  T+ ++  D  +M  +   GK RTE+EF+ L  ++GF  ++     +   L+E  K
Sbjct:  143 DAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDC-IMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLK 361          
BLAST of FC931087 vs. ExPASy Swiss-Prot
Match: COMT1_SACOF (Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.207e-46
Identity = 98/222 (44.14%), Postives = 131/222 (59.01%), Query Frame = 3
Query:   12 EAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFXK 677
            +AVLD  I PF K +G  A+ Y+G  P  N +  + M   SV     +L+ Y GF+GV  LVDVGG  G  L  I   HP I +GINFDLP V++EAP  PGV H+GGDMFKS+PA DAI MKW+L  W+D  C  +++NCY ALP  GK+I  E VLP ++    + + +   D+ +M  +   G+ R E+EF  L   AGF   +A Y+      +EF K
Sbjct:  144 DAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFEGVSTLVDVGGGIGATLHAITSHHPQI-KGINFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIIVECVLPVNTEAVPKAQGVFHVDM-IMLAHNPGGRERYEREFHDLAKGAGFSGFKATYIYANAWAIEFIK 362          
The following BLAST results are available for this feature:
BLAST of FC931087 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
COMT1_MEDSA4.023e-4844.14Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_COFCA8.962e-4847.34Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]
COMT1_CAPAN1.997e-4743.69Caffeic acid 3-O-methyltransferase OS=Capsicum ann... [more]
COMT1_CAPCH3.406e-4743.24Caffeic acid 3-O-methyltransferase OS=Capsicum chi... [more]
COMT1_MAIZE4.448e-4743.69Caffeic acid 3-O-methyltransferase OS=Zea mays PE=... [more]
COMT1_OCIBA5.809e-4743.69Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]
COMT2_OCIBA1.690e-4643.69Caffeic acid 3-O-methyltransferase 2 OS=Ocimum bas... [more]
COMT1_ROSCH1.690e-4643.69Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
OMT1_ARATH2.207e-4641.89Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
COMT1_SACOF2.207e-4644.14Caffeic acid 3-O-methyltransferase OS=Saccharum of... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101C08EF PostHarvP1 Citrus clementina cDNA clone C34101C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931087 ID=FC931087|Name=FC931087|organism=Citrus clementina|type=EST|length=721bp
CTTTGGTGCACGAGGCCGTTCTGGACCCAACTATTGAGCCATTTGTGAAA
GTCCATGGCGAGCCGGCATATAGTTATTATGGGAAGAAGCCTGAAATGAA
CGGCTTGATGCGAAAAGCCATGTCGGGAGTGTCCGTGCCGTTCATGACGT
CCGTTTTGGACGGTTACGATGGGTTCAAAGGTGTGAAGCGATTGGTTGAT
GTGGGTGGGAGTGCAGGTGATTGCCTGAGGATGATATTACAGAAACATCC
TTTTATATGTGAAGGGATCAATTTTGATTTGCCTGAGGTTGTTGCCGAAG
CTCCAAGTATCCCTGGAGTGACCCATATTGGTGGGGACATGTTTAAGTCC
ATTCCTGCCGCTGATGCTATCTTTATGAAGTGGGTTTTAACTACATGGAC
TGACGATGAATGCAAGCTGATAATGGAGAACTGTTACAAGGCTCTTCCGG
CAGGAGGAAAACTGATTGCTTGTGAGCCCGTGCTGCCTGATGATTCAAAC
GAGAGTCAGAGGACGCGTGCTCTCTTAGAAGGGGACATTTTTGTAATGAC
CATCTACAGGGCCAAAGGTAAACACAGGACTGAACAAGAGTTTAAGCAAC
TTGGTCTCTCTGCTGGTTTTCCACACTTGAGAGCTTTTTATGTCGATTAT
TTTCACACTCTTCTTGAGTTCCNAAAGTAATTTTAGTTTCTGGATCCTTA
AAGACTTGGGGAATATTTGTG
back to top