FC931090

Overview
NameFC931090
Unique NameFC931090
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length757
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15271 contig Ccv1_Contig15271:1..758. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIK2_ARATH (3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 1.722e-63
Identity = 124/181 (68.51%), Postives = 139/181 (76.80%), Query Frame = 3
Query:  174 MEKAXXXXXXXXXXXXPSSSQTSDSPA-ISASICSAGEAAGYHRKPAFDDDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQLTP 713
            MEKA            PSSS + +  A +SAS C AG++A Y R   + DDVVIVAA+RT +CK+KRG FKDT  DDLLAPVL+A+IEKT LNPSEVGDIVVGTVLAPGS RA ECRMAAFYAGFPETV +RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMT N ++  G + P
Sbjct:    1 MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP 181          

HSP 2 Score: 29.261 bits (64), Expect = 1.722e-63
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 2
Query:  704 VNPQVEIFTQARDCLLPM 757
            VNP V+ F QA++CLLPM
Sbjct:  179 VNPAVKKFAQAQNCLLPM 196          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIK1_ARATH (3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana GN=KAT1 PE=1 SV=2)

HSP 1 Score: 219.935 bits (559), Expect = 9.133e-59
Identity = 119/180 (66.11%), Postives = 133/180 (73.89%), Query Frame = 3
Query:  174 MEKAXXXXXXXXXXXXPSSSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQLTP 713
            MEKA            PSSS  +   ++SAS C + ++A Y     + DDVVIVAA RTA+CKAKRG FKDT  D+LLA VL+A+IEKT +NPSEVGDIVVGTVL PGS RA ECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMT N     G + P
Sbjct:    1 MEKATERQRILLRHLQPSSSSDA---SLSASACLSKDSAAYQ----YGDDVVIVAAQRTALCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP 173          

HSP 2 Score: 28.8758 bits (63), Expect = 9.133e-59
Identity = 12/18 (66.67%), Postives = 14/18 (77.78%), Query Frame = 2
Query:  704 VNPQVEIFTQARDCLLPM 757
            VNP V+ F QA +CLLPM
Sbjct:  171 VNPNVKKFEQAHNCLLPM 188          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIK5_ARATH (3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana GN=KAT5 PE=2 SV=2)

HSP 1 Score: 206.453 bits (524), Expect = 9.814e-55
Identity = 104/155 (67.10%), Postives = 127/155 (81.94%), Query Frame = 3
Query:  225 SSSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSI 689
            S+S     P++ + +    E +      AF DD+VIVAAYRTAICKA+RGGFKDTL DDLLA VLKAV+E+T L+PSEVGDIVVGTV+APGS RAMECR+AA++AGFP++VP+RTVNRQCSSGLQAVADVA +I+AG YDIGI AG+ESM+ + I
Sbjct:   21 SNSSLKHEPSLLSPVNCVSEVSPM---AAFGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHI 172          

HSP 2 Score: 28.8758 bits (63), Expect = 9.814e-55
Identity = 11/17 (64.71%), Postives = 14/17 (82.35%), Query Frame = 2
Query:  707 NPQVEIFTQARDCLLPM 757
            NP+ + F +ARDCLLPM
Sbjct:  181 NPRAQDFPKARDCLLPM 197          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIKB_RAT (3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus GN=Acaa1b PE=2 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 6.834e-33
Identity = 80/163 (49.08%), Postives = 106/163 (65.03%), Query Frame = 3
Query:  228 SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQLTPK 716
            + ++  S A+ A+ CSAG         A   DVV+V   RT I +A RGGFKDT  D+LL+ VL AV++  +L P  +GDI VG VL PG+  AM  R+A F +G PETVPL  VNRQCSSGLQAVA++A  I+ G YDIG+A G+ESMT++     G ++ +
Sbjct:   12 AGRSESSSALQAAPCSAGFPQ------ASASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGAGAAM-ARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSR 167          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIKA_MOUSE (3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus GN=Acaa1a PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 6.834e-33
Identity = 80/164 (48.78%), Postives = 108/164 (65.85%), Query Frame = 3
Query:  228 SSQTSDSPAISASICSAGEAAGYHRKP-AFDDDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQLTPK 716
            + +   S A+ A+ CSA       R P A   DVV+V   RT I +A RGGFK+T  D+LL+ VL AV++  RL P ++GDI VG VL PG+   M  R+A F +G PETVPL TVNRQCSSGLQAVA++A  I+ G YDIG+A G+ESM+++ +   G ++ +
Sbjct:   12 AGRPESSSALQAAPCSA-------RFPQASASDVVVVHGRRTPIGRASRGGFKNTTPDELLSAVLTAVLQDVRLKPEQLGDISVGNVLEPGAGAVM-ARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSGMGNPGNISSR 167          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIKB_MOUSE (3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus GN=Acaa1b PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.976e-32
Identity = 79/163 (48.47%), Postives = 105/163 (64.42%), Query Frame = 3
Query:  228 SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQLTPK 716
            + +   S A+ A+ CSAG         A   DVV+V   RT I +A RG FKDT  D+LL+ VL AV++  +L P ++GDI VG VL PG+   M  R+A F +G PETVPL TVNRQCSSGLQAVA++A  I+ G YDIG+A G+ESMT++     G ++ +
Sbjct:   12 AGRPESSSALQAAPCSAGFLQ------ASASDVVVVHGRRTPIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGAGAIM-ARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSQRGNHGNISSR 167          

HSP 2 Score: 21.1718 bits (43), Expect = 1.976e-32
Identity = 7/9 (77.78%), Postives = 9/9 (100.00%), Query Frame = 2
Query:  731 QARDCLLPM 757
            +ARDCL+PM
Sbjct:  173 KARDCLIPM 181          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIK_HUMAN (3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens GN=ACAA1 PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 4.365e-32
Identity = 72/132 (54.55%), Postives = 92/132 (69.70%), Query Frame = 3
Query:  321 DVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQLTPK 716
            DVV+V   RTAIC+A RGGFKDT  D+LL+ V+ AV++   L P ++GDI VG VL PG+   M  R+A F +  PETVPL TVNRQCSSGLQAVA +A  I+ G YDIG+A G+ESM++      G +T +
Sbjct:   37 DVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIM-ARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSR 167          

HSP 2 Score: 21.1718 bits (43), Expect = 4.365e-32
Identity = 7/9 (77.78%), Postives = 9/9 (100.00%), Query Frame = 2
Query:  731 QARDCLLPM 757
            +ARDCL+PM
Sbjct:  173 KARDCLIPM 181          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIKA_RAT (3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus GN=Acaa1a PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 6.121e-31
Identity = 77/163 (47.24%), Postives = 104/163 (63.80%), Query Frame = 3
Query:  228 SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQLTPK 716
            + +   S A+ A+ CSA          A   DVV+V   RT I +A RGGFKDT  D+LL+ VL AV++  +L P  +GDI VG VL PG+   M  R+A F +G PETVPL  VNRQCSSGLQAVA++A  I+ G YDIG+A G+ESM++++    G ++ +
Sbjct:   12 AGRPESSSALQAAPCSATFPQ------ASASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGAGAVM-ARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSNRGNPGNISSR 167          

HSP 2 Score: 21.1718 bits (43), Expect = 6.121e-31
Identity = 7/9 (77.78%), Postives = 9/9 (100.00%), Query Frame = 2
Query:  731 QARDCLLPM 757
            +ARDCL+PM
Sbjct:  173 KARDCLIPM 181          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIK_YARLI (3-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia lipolytica GN=POT1 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.475e-27
Identity = 65/120 (54.17%), Postives = 85/120 (70.83%), Query Frame = 3
Query:  318 DDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMT 677
            DDVVI AAYRTA  K  +G FKDT + +LLA +L+ ++++++++P  +GD+V G VLA G+  A E R A   AG PETVP   +NRQCSSGL AV DVA  I+AG  DIGI  G+ESM+
Sbjct:   28 DDVVITAAYRTAHTKGGKGLFKDTSSSELLASLLEGLVKESKIDPKLIGDVVCGNVLAAGAG-ATEHRAACLVAGIPETVPFVALNRQCSSGLMAVNDVANKIRAGQIDIGIGCGVESMS 146          
BLAST of FC931090 vs. ExPASy Swiss-Prot
Match: THIKB_CANTR (3-ketoacyl-CoA thiolase B, peroxisomal OS=Candida tropicalis PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.209e-21
Identity = 59/124 (47.58%), Postives = 78/124 (62.90%), Query Frame = 3
Query:  318 DDVVIVAAYRTAICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVL--APGSTRAMECRMAAFYAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN 683
            DDVVIVAAYRTAI K  +G F++  ++ +L   LK  I+KT ++PS + D+ +G VL  A G+T   E R A   AG P T     VNR CSSGL A++D+A  IK G  + G+A G ESM+ N
Sbjct:   25 DDVVIVAAYRTAIGKGFKGSFRNVHSEFILTEFLKEFIKKTNIDPSLIEDVAIGNVLNQAAGAT---EHRGACLAAGIPYTAAFIAVNRFCSSGLMAISDIANKIKTGEIECGLAGGAESMSTN 145          
The following BLAST results are available for this feature:
BLAST of FC931090 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
THIK2_ARATH1.722e-6368.513-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidop... [more]
THIK1_ARATH9.133e-5966.113-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidop... [more]
THIK5_ARATH9.814e-5567.103-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidop... [more]
THIKB_RAT6.834e-3349.083-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus n... [more]
THIKA_MOUSE6.834e-3348.783-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musc... [more]
THIKB_MOUSE1.976e-3248.473-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musc... [more]
THIK_HUMAN4.365e-3254.553-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapie... [more]
THIKA_RAT6.121e-3147.243-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus n... [more]
THIK_YARLI1.475e-2754.173-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia l... [more]
THIKB_CANTR1.209e-2147.583-ketoacyl-CoA thiolase B, peroxisomal OS=Candida ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101C11EF PostHarvP1 Citrus clementina cDNA clone C34101C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931090 ID=FC931090|Name=FC931090|organism=Citrus clementina|type=EST|length=757bp
GAGTGTCCTATAATTTCCCAAGTATATTTCAGGGGGCCAAAAAAAAAAAA
AAAAAAAAAAACAGGTACTATAACTTCNGGAGTAGATTCAAACCAGGAAA
GAGTAAACAAGTCATCCCTGGTTCTCGATTCATCAGAACTCAAAAGCTTT
CCATTGAAACCTGAGAGTGAGAGATGGAGAAAGCTCTTCACAGACAGAGA
ATTCTGCTTCAACATCTTCAACCTTCTTCTTCCCAAACCAGTGACTCGCC
GGCTATTTCTGCTTCGATTTGTTCGGCTGGTGAAGCTGCAGGATACCATA
GGAAGCCTGCTTTCGATGATGATGTCGTAATTGTGGCTGCATACCGTACT
GCAATTTGCAAGGCGAAACGTGGAGGCTTCAAGGATACTCTTGCCGATGA
TCTGCTTGCACCTGTTCTAAAGGCAGTGATAGAGAAAACGAGGTTGAATC
CCAGTGAAGTAGGGGATATAGTTGTTGGTACAGTCTTGGCACCTGGCTCA
ACAAGAGCCATGGAGTGTAGGATGGCAGCGTTCTATGCTGGTTTCCCTGA
AACGGTGCCCCTCAGAACTGTCAACAGGCAGTGTTCATCTGGCTTGCAGG
CGGTTGCTGATGTTGCAACAGCTATAAAAGCTGGATTGTATGACATTGGT
ATTGCTGCTGGATTGGAAAGCATGACTGTGAATTCTATTAGCGTTGTTGG
CCAGTTAACCCCCAAGTGGAGATCTTTACTCAAGCTCGGGACTGTCTGCT
TCCTATG
back to top