FC931091

Overview
NameFC931091
Unique NameFC931091
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length695
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.584e-86
Identity = 154/215 (71.63%), Postives = 181/215 (84.19%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKALINATLNHYXDAFGNA 694
            MA+LKVP+  P   +DAEQLHKAF GWGTNE LIIS+LAHRNAAQR LIR +Y  TY EDLLKALDKELSSDFER+V+LWTL P ERDAYLA E+TK  T +NWVL+EIACTR + +L+  KQAY ARYKKS+EEDVA HTSGD RKLL+PLVSTFRY+G DVNMMLAR+EAKI+ +K+S+K Y+ ++ IRILTTRSKA + ATLNHY + +GNA
Sbjct:    1 MASLKVPSNVPLPEDDAEQLHKAFSGWGTNEKLIISILAHRNAAQRSLIRSVYAATYNEDLLKALDKELSSDFERAVMLWTLDPPERDAYLAKESTKMFTKNNWVLVEIACTRPALELIKVKQAYQARYKKSIEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKILHEKVSEKSYSDDDFIRILTTRSKAQLGATLNHYNNEYGNA 215          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 4.769e-83
Identity = 151/215 (70.23%), Postives = 176/215 (81.86%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKALINATLNHYXDAFGNA 694
            MA+LKVP   P   EDAEQL+KAF+GWGTNE +IIS+LAHRNA QR  IR +Y   Y +DLLK LD+ELS DFER+V+LWT  PAERDAYLA E+TK  T +NWVL+EIACTRS+ +L  AKQAY ARYK SLEEDVAYHTSGD RKLLVPLVSTFRYDG +VNM LAR+EAKI+ +KI +K YA ++LIRILTTRSKA I+ATLNHY + FG +
Sbjct:    1 MASLKVPATVPLPEEDAEQLYKAFKGWGTNERMIISILAHRNATQRSFIRAVYAANYNKDLLKELDRELSGDFERAVMLWTFEPAERDAYLAKESTKMFTKNNWVLVEIACTRSALELFNAKQAYQARYKTSLEEDVAYHTSGDIRKLLVPLVSTFRYDGDEVNMTLARSEAKILHEKIKEKAYADDDLIRILTTRSKAQISATLNHYKNNFGTS 215          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.037e-82
Identity = 150/213 (70.42%), Postives = 179/213 (84.04%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKALINATLNHYXDAFG 688
            MATLKV    P+ ++DAEQL  AF+GWGTNE LIIS+LAHR+A QRK+IR+ Y+ETYGEDLLK LDKELS+DFER++LLWTL P ERDA LANEATKR TSSN VLME+ACTR+S  LL A+QAYHARYKKSLEEDVA+HT+GDFRKLLV LV+++RY+G +VNM LA+ EAK++ +KI DK Y  E++IRIL+TRSKA INAT N Y D  G
Sbjct:    1 MATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHG 213          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 4.178e-79
Identity = 146/217 (67.28%), Postives = 170/217 (78.34%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGG--DVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKALINATLNHYXDAFGNA 694
            MA+LK+P   P   ED+EQLHKAF+GWGTNE +IIS+LAHRNA QR  IR +Y   Y +DLLK LD ELS DFER V+LWTL P ERDAYLANE+TK  T + WVL+EIACTR S +    KQAYH RYK SLEEDVAYHTSG+ RKLLVPLVSTFRYDG   +VN+ LAR+EAK +  KI++K Y  E+LIRILTTRSKA INATLNH+ D FG++
Sbjct:    1 MASLKIPANIPLPEEDSEQLHKAFKGWGTNEGMIISILAHRNATQRSFIRAVYAANYNKDLLKELDGELSGDFERVVMLWTLDPTERDAYLANESTKLFTKNIWVLVEIACTRPSLEFFKTKQAYHVRYKTSLEEDVAYHTSGNIRKLLVPLVSTFRYDGNADEVNVKLARSEAKTLHKKITEKAYTDEDLIRILTTRSKAQINATLNHFKDKFGSS 217          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 1.650e-59
Identity = 120/213 (56.34%), Postives = 148/213 (69.48%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKALINATLNHYXDAFG 688
            MATL  P     A EDAE L K+ +GWGTNE  IIS+L HRNA QRK IR  Y + Y EDLLK L+ ELS DFE++V  WTL PA+RDA LAN A K+ T    V++EI+C  S  +LLA ++AY  RYK S+EED+A HT+GD RKLLV LV+ +RYDG ++N  LA +EA I+ D I DK + HEE+IRIL+TRSK  + AT N Y D  G
Sbjct:    1 MATLVSPPNF-CAKEDAEALRKSVKGWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDLLKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKSTDVYNVIIEISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILHDAIKDKAFNHEEIIRILSTRSKTQLMATFNKYRDDQG 212          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 7.702e-41
Identity = 92/218 (42.20%), Postives = 130/218 (59.63%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN-----EATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKALINATLNHYXDAFG 688
            MAT++VP + PS A+D+E L +A +GWGT+E  II VL  R+ +QR+ IRE + E YG+DL+  L  ELS DF ++V+ WT  PAERDA L N     E  K+   +  V++EI+CT S   L+A ++AY + +  SLEE +A        KLLV L STFRYD    +  +A  EA ++R+ I  K   H+ ++ IL TRS   +  T   Y   +G
Sbjct:    1 MATIRVPNEVPSPAQDSETLKQAIRGWGTDEKAIIRVLGQRDQSQRRKIRESFREIYGKDLIDVLSSELSGDFMKAVVSWTYDPAERDARLVNKILNKEKKKKSLENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHIASSLPFPLAKLLVTLASTFRYDKDRTDAEVATIEAAMLREAIEKKQLDHDHVLYILGTRSIYQLRETFVAYKKNYG 218          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANXD5_ARATH (Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 9.119e-34
Identity = 75/214 (35.05%), Postives = 123/214 (57.48%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKALINATLNHYXDAFG 688
            MAT+K+P   PS   DA+QL KAF+G G + ++II++LAHRNA QR LI + Y   + +DL K L  EL    +++VLLW     ERDA +   + +   + +  + EI CTRS   L   KQ Y   +   LEED+    SG+ +++L+  ++T RY+G +++      +A+ ++  ++ K  + ++ LI+I T RS+  + A  + Y   +G
Sbjct:    1 MATMKIPMTVPSPRVDADQLFKAFKGRGCDTSVIINILAHRNATQRALIEQEYETKFSDDLRKRLHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGSQLRQIKQVYSNTFGVKLEEDIESEASGNHKRVLLAYLNTTRYEGPEIDNASVENDARTLKSAVARKHKSDDQTLIQIFTDRSRTHLVAVRSTYRSMYG 214          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANXD4_ARATH (Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.363e-29
Identity = 76/217 (35.02%), Postives = 122/217 (56.22%), Query Frame = 2
Query:   80 PSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDK-------ELSSDFER---SVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKIS---DKDYAHEELIRILTTRSKALINATLNHYXDAFGN 691
            P   E   +   A  G G +E  +IS L       RKL R+     + ED  +A +K        L  +F R   +V++W + P ERDA L  +A K+   +  +++E++CTRS+ DLL A++AYH+ + +S+EED+A H  G  RKLLV LVS +RY+G  V    A+++AKI+ + ++   ++    +E++RILTTRSK  +     H+ +  G+
Sbjct:    4 PLELESLTEAISAGMGMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNTAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEAVEKDEVVRILTTRSKLHLQHLYKHFNEIKGS 220          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANX13_HUMAN (Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3)

HSP 1 Score: 127.102 bits (318), Expect = 8.833e-29
Identity = 75/200 (37.50%), Postives = 119/200 (59.50%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI--RILTTRSKALINATLNHYXDAFG 688
            DA++L+KA +G GTNEA II +L+ R + +R+ I++ Y  TYG++L + L  ELS +FE++ L     P+E  A    +A K L +   VL+E+ CTR++++++A K+AY   + +SLE DV   TSG+ +K+LV L+   R +G DV+  LA  +AK + D   +  +  +EL    +L  RS   + AT   Y    G
Sbjct:   19 DAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD-AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIG 217          

HSP 2 Score: 79.7221 bits (195), Expect = 1.617e-14
Identity = 49/145 (33.79%), Postives = 77/145 (53.10%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNW---VLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A +DA+ L+ A +G WGT+E     VLA R+  Q +   + Y    G+D+ +A+++E S D +++ L       + + Y A    K +  +      L+ I  TR+  DL   K  +  +Y+KSL + V   TSGDFRKLLV L+
Sbjct:  171 AGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315          
BLAST of FC931091 vs. ExPASy Swiss-Prot
Match: ANX13_CANFA (Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 8.833e-29
Identity = 74/195 (37.95%), Postives = 117/195 (60.00%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI--RILTTRSKALINATLNHY 673
            DA++L+KA +G GT+EA II +L+ R + +R+ I++ Y  TYG+DL +    +LS +FE++ L     P+E DA    +A K L +   VL+EI CTR++++++A K+AY   + +SLE DV   TSG+ + +LV L+   R +G DV+  LA  +AK + D   D  +  +EL    +L  RS   + AT   Y
Sbjct:   19 DAKKLNKACKGMGTDEAAIIEILSSRTSDERQQIKQKYKATYGKDLEEVFKSDLSGNFEKTALALLDRPSEYDARQLQKAMKGLGTDEAVLIEILCTRTNKEIMAIKEAYQRLFDRSLESDVKADTSGNLKAILVSLLQANRDEGDDVDKDLAGQDAKDLYD-AGDGRWGTDELAFNEVLAKRSHKQLRATFQAY 212          

HSP 2 Score: 76.2554 bits (186), Expect = 1.788e-13
Identity = 47/145 (32.41%), Postives = 76/145 (52.41%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNW---VLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A +DA+ L+ A  G WGT+E     VLA R+  Q +   + Y     +D+ +A++ E S D +++ L       +++ Y A+   K +  +      L+ I  TR+  DL   K  +  +Y+KSL + V   TSGDF+KLLV L+
Sbjct:  171 AGQDAKDLYDAGDGRWGTDELAFNEVLAKRSHKQLRATFQAYQILIDKDIEEAIEAETSGDLQKAYLTLVRCARDQEGYFADRLYKSMKGTGTDEETLIHIIVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFQKLLVALL 315          
The following BLAST results are available for this feature:
BLAST of FC931091 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXD2_ARATH1.584e-8671.63Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANXD7_ARATH4.769e-8370.23Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANXD1_ARATH4.037e-8270.42Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANXD6_ARATH4.178e-7967.28Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANX4_FRAAN1.650e-5956.34Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD3_ARATH7.702e-4142.20Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANXD5_ARATH9.119e-3435.05Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV... [more]
ANXD4_ARATH1.363e-2935.02Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV... [more]
ANX13_HUMAN8.833e-2937.50Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3[more]
ANX13_CANFA8.833e-2937.95Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101C12EF PostHarvP1 Citrus clementina cDNA clone C34101C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931091 ID=FC931091|Name=FC931091|organism=Citrus clementina|type=EST|length=695bp
GACTGCCTCGTCATTTTCTATCTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTACTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACTGA
TAAATGCGACCCTCAATCACTACNATGATGCTTTTGGAAATGCCA
back to top