FC931094

Overview
NameFC931094
Unique NameFC931094
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length662
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931094 vs. ExPASy Swiss-Prot
Match: ACY1_DICDI (Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.233e-37
Identity = 90/226 (39.82%), Postives = 130/226 (57.52%), Query Frame = 2
Query:    2 TNEFRELNVGFVMDEGQASTNDDFRVFYADRSPWHLIIRAKGAPGHGSRMFDNGAMENLMKSVEMITNFRESQFDVVKAGR----AANSEVISVNPVYLKAGIP--SPTGFVMNMQPSEAKAGFDVRLPPTADPDLIRRRIAEEWAPAIRNMSYEIIEKGPIRDYKGRPLMTLTDDSNPWWSVFKQAVTSAGGKLGKPEILASTTDARYMRQLGIPALGFSPMANT 661
            T +FR+LN+G  +DEG AS  +DF VFY +R+PW + I A G  GHGSR  +  A+E LM+++  +  FR+ QF+ +  G+        +V S+N   LKAGIP      F  N+ P++A+AGFD+R+PPT + D    +I +EW  A   +S++     P  +      MT  D  N WW  FK++       L   EI  + TD+R++R LGIPA GFSP+ NT
Sbjct:  158 TEKFRQLNIGLCLDEGLASPTNDFTVFYGERAPWWVHITAVGNAGHGSRFIEGTAIEKLMRTINKMLAFRQEQFESLHHGQHECGKKLGDVTSLNLTVLKAGIPIDHSNNFSYNVIPTQAEAGFDIRIPPTVNLDQFLDQI-KEWT-AEEGLSFKFASYIPKNE------MTKLDSDNKWWENFKESCKKMDINL-VTEIFPAATDSRFIRNLGIPAFGFSPINNT 374          
BLAST of FC931094 vs. ExPASy Swiss-Prot
Match: ACY1_MOUSE (Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.142e-33
Identity = 82/219 (37.44%), Postives = 116/219 (52.97%), Query Frame = 2
Query:    8 EFRELNVGFVMDEGQASTNDDFRVFYADRSPWHLIIRAKGAPGHGSRMFDNGAMENLMKSVEMITNFRESQFDVVKAG-RAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAKAGFDVRLPPTADPDLIRRRIAEEWAPAIRNMSYEIIEKGPIRDYKGRPLMTLTDDSNPWWSVFKQAVTSAGGKLGKPEILASTTDARYMRQLGIPALGFSPMANT 661
            EF+ L  GF +DEG A+  D F VFY++RSPW + + + G PGH SR  ++ A E L K +  I  FRE +   ++A        V SVN   L+ G+        N+ P+   A FD R+ P  D     +++      A   +++E  +K         P MT TDDS+PWW+ F  A  +    L +PEI  + TD+RY+R +GIPALGFSPM  T
Sbjct:  163 EFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGV------AYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFT------EPRMTPTDDSDPWWAAFSGACKAMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNRT 368          
BLAST of FC931094 vs. ExPASy Swiss-Prot
Match: ACY1A_RAT (Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.194e-32
Identity = 82/219 (37.44%), Postives = 115/219 (52.51%), Query Frame = 2
Query:    8 EFRELNVGFVMDEGQASTNDDFRVFYADRSPWHLIIRAKGAPGHGSRMFDNGAMENLMKSVEMITNFRESQFDVVKAG-RAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAKAGFDVRLPPTADPDLIRRRIAEEWAPAIRNMSYEIIEKGPIRDYKGRPLMTLTDDSNPWWSVFKQAVTSAGGKLGKPEILASTTDARYMRQLGIPALGFSPMANT 661
            EF+ L  GF +DEG A+  D F VFY++RSPW + + + G PGH SR  ++ A E L K V  I  FRE +   ++A        V SVN   L+ G+        N+ P+   A FD R+ P  D     +++      A   +++E  +K         P MT TDD++PWW+ F  A       L +PEI  + TD+RY+R +GIPALGFSPM  T
Sbjct:  163 EFQALRAGFALDEGLANPTDAFTVFYSERSPWWIRVTSTGKPGHASRFIEDTAAEKLHKVVNSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGV------AYNVVPATMSACFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQKFT------EPRMTPTDDTDPWWAAFSGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNRT 368          
BLAST of FC931094 vs. ExPASy Swiss-Prot
Match: ACY1_PIG (Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 2.660e-32
Identity = 80/218 (36.70%), Postives = 115/218 (52.75%), Query Frame = 2
Query:    8 EFRELNVGFVMDEGQASTNDDFRVFYADRSPWHLIIRAKGAPGHGSRMFDNGAMENLMKSVEMITNFRESQFDVVKAGRAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAKAGFDVRLPPTADPDLIRRRIAEEWAPAIRNMSYEIIEKGPIRDYKGRPLMTLTDDSNPWWSVFKQAVTSAGGKLGKPEILASTTDARYMRQLGIPALGFSPMANT 661
            EF+ L  GF +DEG AS  D F VFY++RSPW L + + G PGHGSR  ++ A E L K +  I  FRE +   +++ +     V SVN   L+ G+        N+ P+   A FD R+ P  D      ++      A   +++E ++K           +T TDDS+PWW+ F          L + EI  ++TDARY+R  G+PALGFSPM +T
Sbjct:  163 EFQALRAGFALDEGLASPTDAFTVFYSERSPWWLRVTSTGKPGHGSRFIEDTAAEKLHKVINSILAFREKEKQRLQSNQLKPGAVTSVNLTMLEGGV------AYNVVPATMSACFDFRVAPDVDLKAFEEQLQSWCQAAGEGVTFEFVQKWM------ETQVTSTDDSDPWWAAFSGVFKDMKLAL-ELEICPASTDARYIRAAGVPALGFSPMNHT 367          
BLAST of FC931094 vs. ExPASy Swiss-Prot
Match: ACY1B_RAT (Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.660e-32
Identity = 81/220 (36.82%), Postives = 115/220 (52.27%), Query Frame = 2
Query:    5 NEFRELNVGFVMDEGQASTNDDFRVFYADRSPWHLIIRAKGAPGHGSRMFDNGAMENLMKSVEMITNFRESQFDVVKAG-RAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAKAGFDVRLPPTADPDLIRRRIAEEWAPAIRNMSYEIIEKGPIRDYKGRPLMTLTDDSNPWWSVFKQAVTSAGGKLGKPEILASTTDARYMRQLGIPALGFSPMANT 661
            +EF  L  GF +DEG A+  D F VFY++RSPW + + + G PGH SR  ++ A E L K V  I  FRE ++  +++        V SVN   L+ G+        N+ P+   A FD R+ P  D      ++      A   +++E  +K         P MT TDD++PWW+ F  A       L +PEI  + TD+RY+R +GIPALGFSPM  T
Sbjct:  162 HEFHALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGV------AYNVVPATMSACFDFRVAPDVDMKAFEEQLQSWCQEAGEGVTFEFAQKFT------EPRMTPTDDTDPWWAAFSGACKEMTLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNRT 368          
BLAST of FC931094 vs. ExPASy Swiss-Prot
Match: ACY1_HUMAN (Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.926e-32
Identity = 80/219 (36.53%), Postives = 113/219 (51.60%), Query Frame = 2
Query:    8 EFRELNVGFVMDEGQASTNDDFRVFYADRSPWHLIIRAKGAPGHGSRMFDNGAMENLMKSVEMITNFRESQFDVVKAG-RAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAKAGFDVRLPPTADPDLIRRRIAEEWAPAIRNMSYEIIEKGPIRDYKGRPLMTLTDDSNPWWSVFKQAVTSAGGKLGKPEILASTTDARYMRQLGIPALGFSPMANT 661
            EF  L  GF +DEG A+  D F VFY++RSPW + + + G PGH SR  ++ A E L K V  I  FRE ++  +++        V SVN   L+ G+        N+ P+   A FD R+ P  D      ++      A   ++ E  +K         P +T TDDSNPWW+ F +        L +PEI+ + TD RY+R +G+PALGFSPM  T
Sbjct:  163 EFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGV------AYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWM------HPQVTPTDDSNPWWAAFSRVCKDMNLTL-EPEIMPAATDNRYIRAVGVPALGFSPMNRT 368          
BLAST of FC931094 vs. ExPASy Swiss-Prot
Match: ACY1_PONAB (Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 7.740e-32
Identity = 81/219 (36.99%), Postives = 113/219 (51.60%), Query Frame = 2
Query:    8 EFRELNVGFVMDEGQASTNDDFRVFYADRSPWHLIIRAKGAPGHGSRMFDNGAMENLMKSVEMITNFRESQFDVVKAG-RAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAKAGFDVRLPPTADPDLIRRRIAEEWAPAIRNMSYEIIEKGPIRDYKGRPLMTLTDDSNPWWSVFKQAVTSAGGKLGKPEILASTTDARYMRQLGIPALGFSPMANT 661
            EF  L  GF +DEG A+  D F VFY++RSPW + + + G PGH SR  ++ A E L K V  I  FRE ++  +++        V SVN   L+ G+        N+ P+   A FD R+ P  D      ++      A   ++ E  +K         P +T TDDSNPWW+ F +        L +PEI+ + TD RY+R +GIPALGFSPM  T
Sbjct:  163 EFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVSSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGV------AYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWM------HPQVTPTDDSNPWWAAFSRVCKDMKLTL-EPEIMPAATDNRYIRAVGIPALGFSPMNRT 368          
The following BLAST results are available for this feature:
BLAST of FC931094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
ACY1_DICDI1.233e-3739.82Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1... [more]
ACY1_MOUSE3.142e-3337.44Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1[more]
ACY1A_RAT1.194e-3237.44Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1... [more]
ACY1_PIG2.660e-3236.70Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2[more]
ACY1B_RAT2.660e-3236.82Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1... [more]
ACY1_HUMAN5.926e-3236.53Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1[more]
ACY1_PONAB7.740e-3236.99Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2[more]
back to top
Properties
Property NameValue
Genbank descriptionC34101D03EF PostHarvP1 Citrus clementina cDNA clone C34101D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931094 ID=FC931094|Name=FC931094|organism=Citrus clementina|type=EST|length=662bp
GACTAACGAGTTTCGGGAACTCAATGTTGGGTTTGTTATGGACGAAGGAC
AGGCTTCGACGAACGATGATTTTAGGGTCTTTTACGCGGACAGGTCGCCG
TGGCACTTGATAATTAGAGCTAAAGGTGCGCCGGGGCATGGTTCGAGGAT
GTTTGATAATGGGGCGATGGAGAATTTGATGAAGAGCGTTGAGATGATTA
CCAATTTCAGAGAGAGCCAGTTTGATGTGGTTAAGGCTGGACGAGCGGCG
AACTCTGAGGTCATTTCGGTCAATCCGGTTTATTTGAAAGCTGGCATTCC
GTCACCAACTGGGTTTGTAATGAACATGCAACCTTCGGAGGCTAAGGCCG
GGTTTGATGTTAGATTGCCACCTACGGCAGACCCTGATCTTATCAGAAGG
AGAATTGCCGAAGAATGGGCCCCGGCTATAAGGAATATGTCGTATGAGAT
AATTGAGAAAGGACCGATAAGAGACTACAAGGGCCGTCCTCTAATGACGC
TGACTGATGATTCCAATCCTTGGTGGTCGGTCTTTAAGCAAGCTGTGACA
TCAGCTGGAGGAAAACTTGGAAAGCCTGAAATTTTGGCTTCAACTACTGA
TGCACGCTACATGAGACAGTTGGGAATTCCTGCTCTTGGCTTCTCCCCGA
TGGCGAATACCC
back to top