FC931096

Overview
NameFC931096
Unique NameFC931096
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10403 contig Ccv1_Contig10403:516..1231. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHC_SOLTU (Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2)

HSP 1 Score: 263.077 bits (671), Expect = 1.079e-69
Identity = 119/137 (86.86%), Postives = 131/137 (95.62%), Query Frame = 1
Query:    4 TRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            TRRAYFYWVTREQGSFDWFKG+MNE AE+DH  VIE+HNYCTSVYEEGDARSALI MLQSL+HAK+GVD+VSGTRVKSHFAKPNWRNVYKR+ALNHP+++VGVFYCGAPALTKEL+  AL+FSHKTSTKFDFHKENF
Sbjct:  802 TRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPEAKVGVFYCGAPALTKELKQHALNFSHKTSTKFDFHKENF 938          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHC_ARATH (Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana GN=RBOHC PE=2 SV=2)

HSP 1 Score: 263.077 bits (671), Expect = 1.079e-69
Identity = 120/138 (86.96%), Postives = 131/138 (94.93%), Query Frame = 1
Query:    1 RTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            RTRRAYFYWVTREQGSFDWFK +MNEVAE D N VIE+HNYCTSVYEEGDARSALI MLQSLNHAKNGVD+VSGTRV SHFAKPNWRNVYKR+A++HP+++VGVFYCGAPALTKELRHLALDF+HKTST+F FHKENF
Sbjct:  768 RTRRAYFYWVTREQGSFDWFKNIMNEVAERDANRVIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELRHLALDFTHKTSTRFSFHKENF 905          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHD_SOLTU (Respiratory burst oxidase homolog protein D OS=Solanum tuberosum GN=RBOHD PE=1 SV=2)

HSP 1 Score: 253.447 bits (646), Expect = 8.551e-67
Identity = 115/136 (84.56%), Postives = 128/136 (94.12%), Query Frame = 1
Query:    7 RRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            +R YFYWVTREQGSFDWFKG+MNE+A +D + +IE+HNYCTSVYEEGDARSALIAMLQS+NHAKNGVD+VSGTRVK+HFA+PNWRNVYKR+ALNH D+RVGVFYCGAPALTK L  LALDFSHKTSTKFDFHKENF
Sbjct:  723 KRVYFYWVTREQGSFDWFKGLMNELAVMDCDGIIEMHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSGTRVKTHFARPNWRNVYKRIALNHTDARVGVFYCGAPALTKVLGQLALDFSHKTSTKFDFHKENF 858          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHA_ARATH (Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana GN=RBOHA PE=2 SV=2)

HSP 1 Score: 250.751 bits (639), Expect = 5.543e-66
Identity = 116/138 (84.06%), Postives = 126/138 (91.30%), Query Frame = 1
Query:    1 RTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            RT+RAYFYWVTREQGSFDWFK VM+EV E D  NVIELHNYCTSVYEEGDARSALI MLQSLNHAK+GVDVVSGTRV SHFA+PNWR+V+KR+A+NHP +RVGVFYCGA  L KELRHL+LDFSHKTSTKF FHKENF
Sbjct:  765 RTKRAYFYWVTREQGSFDWFKNVMDEVTETDRKNVIELHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSGTRVMSHFARPNWRSVFKRIAVNHPKTRVGVFYCGAAGLVKELRHLSLDFSHKTSTKFIFHKENF 902          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHD_ARATH (Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana GN=RBOHD PE=1 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.041e-64
Identity = 109/138 (78.99%), Postives = 125/138 (90.58%), Query Frame = 1
Query:    1 RTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            +TR+AYFYWVTREQGSF+WFKG+M+E++ELD   +IELHNYCTSVYEEGDAR ALIAMLQSL HAKNGVDVVSGTRVKSHFAKPNWR VYK++A+ HP  R+GVFYCG P + KEL++LALDFS KT+TKFDFHKENF
Sbjct:  784 KTRKAYFYWVTREQGSFEWFKGIMDEISELDEEGIIELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIAVQHPGKRIGVFYCGMPGMIKELKNLALDFSRKTTTKFDFHKENF 921          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHG_ARATH (Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana GN=RBOHG PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.669e-62
Identity = 105/138 (76.09%), Postives = 126/138 (91.30%), Query Frame = 1
Query:    1 RTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            +TRRAYFYWVT+EQG+FDWFK +MNE+AE D + VIELHN+CTSVYEEGD RSALI MLQSLN+AKNG+D+V+GTRV SHFA+PNW+NVYK++A++HP + VGVFYCGAP LTKELR LAL+F+HKTST+F FHKENF
Sbjct:  726 KTRRAYFYWVTKEQGTFDWFKNIMNEIAERDKSKVIELHNHCTSVYEEGDVRSALIRMLQSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRQLALEFTHKTSTRFSFHKENF 863          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHB_SOLTU (Respiratory burst oxidase homolog protein B OS=Solanum tuberosum GN=RBOHB PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.111e-61
Identity = 105/137 (76.64%), Postives = 120/137 (87.59%), Query Frame = 1
Query:    4 TRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            T+RAYFYWVTREQGSF+WFKGVM+EV+E D   +IELHNYCTSVYEEGDARSALI MLQS+  AK+GVD+VSGTRVK+HFA+PNWR V+KRV +NHPD R+GVFYCG   L  ELRHL+ DFSHKT TKF+FHKENF
Sbjct:  731 TKRAYFYWVTREQGSFEWFKGVMDEVSENDQEGLIELHNYCTSVYEEGDARSALITMLQSIQQAKSGVDIVSGTRVKTHFARPNWRQVFKRVTINHPDQRIGVFYCGPQGLVGELRHLSQDFSHKTGTKFEFHKENF 867          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHB_ARATH (Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.143e-57
Identity = 100/137 (72.99%), Postives = 118/137 (86.13%), Query Frame = 1
Query:    4 TRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            T+RAYFYWVTREQGS +WF  VMNEVAE D   +IELHNYCTSVYEEGDARSALI MLQSL+HAK+G+D+VSGTRV++HFA+PNWR+V+K VA+NH + RVGVFYCG   +  EL+ LA DFS KT+TKF+FHKENF
Sbjct:  707 TKRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSLHHAKSGIDIVSGTRVRTHFARPNWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKRLAQDFSRKTTTKFEFHKENF 843          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHA_SOLTU (Respiratory burst oxidase homolog protein A OS=Solanum tuberosum GN=RBOHA PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.158e-55
Identity = 97/138 (70.29%), Postives = 115/138 (83.33%), Query Frame = 1
Query:    1 RTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            +T  AYFYWVTREQGSFDWFKGVMNEVAELD   VIE+HNY TSVYEEGDARSALI M+Q+LNHAKNGVD+VSGT V++HFA+PNWR V+ +    H ++R+GVFYCGAP L KEL  L  +F+ K +TKF+FHKE+F
Sbjct:  826 KTTNAYFYWVTREQGSFDWFKGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSGTSVRTHFARPNWRKVFSKTLTKHANARIGVFYCGAPILAKELSKLCKEFNQKGTTKFEFHKEHF 963          
BLAST of FC931096 vs. ExPASy Swiss-Prot
Match: RBOHF_ARATH (Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana GN=RBOHF PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.807e-55
Identity = 97/138 (70.29%), Postives = 115/138 (83.33%), Query Frame = 1
Query:    1 RTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 414
            +T  AYFYWVTREQGSFDWFKGVMNEVAELD   VIE+HNY TSVYEEGDARSALI M+Q+LNHAKNGVD+VSGTRV++HFA+PNW+ V  +++  H ++R+GVFYCG P L KEL  L   F+ K STKF+FHKE+F
Sbjct:  807 KTTNAYFYWVTREQGSFDWFKGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSGTRVRTHFARPNWKKVLTKLSSKHCNARIGVFYCGVPVLGKELSKLCNTFNQKGSTKFEFHKEHF 944          
The following BLAST results are available for this feature:
BLAST of FC931096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
RBOHC_SOLTU1.079e-6986.86Respiratory burst oxidase homolog protein C OS=Sol... [more]
RBOHC_ARATH1.079e-6986.96Respiratory burst oxidase homolog protein C OS=Ara... [more]
RBOHD_SOLTU8.551e-6784.56Respiratory burst oxidase homolog protein D OS=Sol... [more]
RBOHA_ARATH5.543e-6684.06Respiratory burst oxidase homolog protein A OS=Ara... [more]
RBOHD_ARATH3.041e-6478.99Respiratory burst oxidase homolog protein D OS=Ara... [more]
RBOHG_ARATH1.669e-6276.09Putative respiratory burst oxidase homolog protein... [more]
RBOHB_SOLTU4.111e-6176.64Respiratory burst oxidase homolog protein B OS=Sol... [more]
RBOHB_ARATH6.143e-5772.99Respiratory burst oxidase homolog protein B OS=Ara... [more]
RBOHA_SOLTU1.158e-5570.29Respiratory burst oxidase homolog protein A OS=Sol... [more]
RBOHF_ARATH9.807e-5570.29Respiratory burst oxidase homolog protein F OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101D05EF PostHarvP1 Citrus clementina cDNA clone C34101D05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931096 ID=FC931096|Name=FC931096|organism=Citrus clementina|type=EST|length=715bp
AGGACAAGAAGAGCATACTTCTATTGGGTTACAAGAGAGCAAGGCTCGTT
CGATTGGTTTAAGGGAGTGATGAATGAGGTGGCTGAATTGGACCACAACA
ATGTCATAGAGCTTCACAATTACTGCACCAGTGTTTATGAAGAAGGTGAT
GCTCGCTCAGCTCTCATTGCCATGCTTCAGTCCCTCAATCACGCCAAGAA
TGGCGTTGACGTTGTCTCTGGAACACGCGTTAAGTCACATTTCGCCAAGC
CTAATTGGCGCAATGTGTACAAACGCGTTGCTCTCAATCACCCTGATTCT
AGAGTTGGTGTTTTCTATTGCGGGGCACCGGCACTGACAAAAGAGCTACG
ACACCTAGCTTTGGATTTCTCTCACAAGACAAGCACCAAGTTTGATTTCC
ATAAAGAAAACTTCTAGATCAAGTCCCTCCTGATTTCCACCATTATATAT
CATCTCTTCCACTCCGTTTTCTCGTACAAAGCCTGTGGCATGGCCCACTG
GCCCTTATGTTTATAGAAAAATCATATCAATATTTGTTTGGTACCCAGTT
GATTTTGCTGCAAAATCACTAATAGAGAGCATTAGAAATATCAAGCGGAC
AAAGGTTGGTGGGTAGTTGATATCAAGGCCACACCACACTGGACACACAA
CACATGGCAAGGGAGATATAGGCCGAAAAAGGGGTTTAGCAAAAAGTCAT
GCTCAGCCATTTCCT
back to top