FC931099

Overview
NameFC931099
Unique NameFC931099
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15088 contig Ccv1_Contig15088:29..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS62_ARATH (40S ribosomal protein S6-2 OS=Arabidopsis thaliana GN=RPS6B PE=1 SV=3)

HSP 1 Score: 351.288 bits (900), Expect = 2.855e-96
Identity = 175/203 (86.21%), Postives = 180/203 (88.67%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQRI 690
            MKFN+ANPTTGCQKKLEIDDDQKLRAFFDKR+SQEV+GDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCF                 CIVSPDLSVLNLVIVKKG  DLPGLTDTEKPRMRGPKRASKIRKLFNL KEDDVRKYVNTYRRTFT K GKKVSKAPKIQRLVTPLTLQRKR RIA+KK+RI
Sbjct:    1 MKFNVANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGVSDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPKIQRLVTPLTLQRKRARIADKKKRI 203          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_ASPOF (40S ribosomal protein S6 OS=Asparagus officinalis GN=rps6 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 3.729e-96
Identity = 175/203 (86.21%), Postives = 180/203 (88.67%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQRI 690
            MKFNIANPTTGCQKKLEIDDDQKLRAF+DKRISQEV+GDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCF                 CIVSPDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFT K GK  SKAPKIQRLVTPLTLQRKR RIAEKK+R+
Sbjct:    1 MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKTCSKAPKIQRLVTPLTLQRKRARIAEKKKRV 203          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS61_ARATH (40S ribosomal protein S6-1 OS=Arabidopsis thaliana GN=RPS6A PE=1 SV=2)

HSP 1 Score: 344.739 bits (883), Expect = 2.672e-94
Identity = 171/203 (84.24%), Postives = 179/203 (88.18%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQRI 690
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+DKRISQEV+GDALGEEFKGYVFKI GGCDKQGFPMKQGVLTPGRVRLLLHRGTPCF                 CIVSPDLSVLNLVIVKKGE+DLPGLTDTEKPRMRGPKRASKIRKLFNL KEDDVR YVNTYRR FT K GK+VSKAPKIQRLVTPLTLQRKR RIA+KK++I
Sbjct:    1 MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIKGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIRKLFNLKKEDDVRTYVNTYRRKFTNKKGKEVSKAPKIQRLVTPLTLQRKRARIADKKKKI 203          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_RAT (40S ribosomal protein S6 OS=Rattus norvegicus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.025e-61
Identity = 127/202 (62.87%), Postives = 147/202 (72.77%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQR 687
            MK NI+ P TGCQK +E+DD++KLR F++KR++ EV  DALGEE+KGYV +I GG DKQGFPMKQGVLT GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  LQ KR RIA KKQR
Sbjct:    1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQR 198          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_MOUSE (40S ribosomal protein S6 OS=Mus musculus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.025e-61
Identity = 127/202 (62.87%), Postives = 147/202 (72.77%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQR 687
            MK NI+ P TGCQK +E+DD++KLR F++KR++ EV  DALGEE+KGYV +I GG DKQGFPMKQGVLT GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  LQ KR RIA KKQR
Sbjct:    1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQR 198          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_MACFA (40S ribosomal protein S6 OS=Macaca fascicularis GN=RPS6 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.025e-61
Identity = 127/202 (62.87%), Postives = 147/202 (72.77%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQR 687
            MK NI+ P TGCQK +E+DD++KLR F++KR++ EV  DALGEE+KGYV +I GG DKQGFPMKQGVLT GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  LQ KR RIA KKQR
Sbjct:    1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQR 198          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_HUMAN (40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.025e-61
Identity = 127/202 (62.87%), Postives = 147/202 (72.77%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQR 687
            MK NI+ P TGCQK +E+DD++KLR F++KR++ EV  DALGEE+KGYV +I GG DKQGFPMKQGVLT GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  LQ KR RIA KKQR
Sbjct:    1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQR 198          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_BOVIN (40S ribosomal protein S6 OS=Bos taurus GN=RPS6 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.748e-61
Identity = 127/202 (62.87%), Postives = 146/202 (72.28%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQR 687
            MK NI+ P TGCQK +E+DD++KLR F++KR++ EV  DALGEE+KGYV +I GG DKQGFPMKQGVLT GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+       K  +KAPKIQRLVTP  LQ KR RIA KKQR
Sbjct:    1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKDGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQR 198          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_APLCA (40S ribosomal protein S6 OS=Aplysia californica GN=RPS6 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.748e-61
Identity = 126/204 (61.76%), Postives = 149/204 (73.04%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKV-SKAPKIQRLVTPLTLQRKRGRIAEKKQRI 690
            MK NI+ P TGCQK +E+DD++KLR F+DKRIS E++ D LG+E+KGYV +I GG DKQGFPMKQGVLT  RVRLLL +   C+                 CIV  +LSVL+LVI+KKGE D+PGLTD   PR  GPKRASKIRKLFNLSKEDDVR+YV   RR    + GKK  SKAPKIQRLVTP+ LQRKR R+A KK+R+
Sbjct:    1 MKLNISYPATGCQKLIEVDDEKKLRPFYDKRISAELSADCLGDEWKGYVVRISGGNDKQGFPMKQGVLTATRVRLLLDKNHSCY--RPRRTGERKRKSVRGCIVDSNLSVLSLVIIKKGEQDIPGLTDKTIPRRLGPKRASKIRKLFNLSKEDDVRQYV--VRRPLPERDGKKAKSKAPKIQRLVTPVVLQRKRARMALKKKRV 200          
BLAST of FC931099 vs. ExPASy Swiss-Prot
Match: RS6_ICTPU (40S ribosomal protein S6 OS=Ictalurus punctatus GN=rps6 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.933e-60
Identity = 123/202 (60.89%), Postives = 147/202 (72.77%), Query Frame = 1
Query:   82 MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRGRIAEKKQR 687
            MK NI+ P TGCQK +E+DD++KLR F++KR++ EV  D LG+E+KGYV +I GG DKQGFPMKQGVLT GRVRLLL +G  C+                 CIV  +LSVLNLVI++KGE D+PGLTD+  PR  GPKRAS+IRKLFNLSKEDDVR+YV   RR  T +  K  +KAPKIQRLVTP  LQ KR RIA K+QR
Sbjct:    1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADPLGDEWKGYVVRISGGNDKQGFPMKQGVLTNGRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVDANLSVLNLVIIRKGEKDIPGLTDSTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRRPLTKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKRQR 198          
The following BLAST results are available for this feature:
BLAST of FC931099 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
RS62_ARATH2.855e-9686.2140S ribosomal protein S6-2 OS=Arabidopsis thaliana... [more]
RS6_ASPOF3.729e-9686.2140S ribosomal protein S6 OS=Asparagus officinalis ... [more]
RS61_ARATH2.672e-9484.2440S ribosomal protein S6-1 OS=Arabidopsis thaliana... [more]
RS6_RAT1.025e-6162.8740S ribosomal protein S6 OS=Rattus norvegicus GN=R... [more]
RS6_MOUSE1.025e-6162.8740S ribosomal protein S6 OS=Mus musculus GN=Rps6 P... [more]
RS6_MACFA1.025e-6162.8740S ribosomal protein S6 OS=Macaca fascicularis GN... [more]
RS6_HUMAN1.025e-6162.8740S ribosomal protein S6 OS=Homo sapiens GN=RPS6 P... [more]
RS6_BOVIN1.748e-6162.8740S ribosomal protein S6 OS=Bos taurus GN=RPS6 PE=... [more]
RS6_APLCA1.748e-6161.7640S ribosomal protein S6 OS=Aplysia californica GN... [more]
RS6_ICTPU1.933e-6060.8940S ribosomal protein S6 OS=Ictalurus punctatus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101D09EF PostHarvP1 Citrus clementina cDNA clone C34101D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931099 ID=FC931099|Name=FC931099|organism=Citrus clementina|type=EST|length=691bp
GAAACCTCAGAGAAGGAGTCGGAGTAGTACTAGAGCCGAAGCGCTTCTCA
TCTCTTTAGCCACAGACTCTATCGAACAAAGATGAAGTTCAATATCGCAA
ATCCCACCACTGGGTGCCAGAAGAAGCTCGAAATTGACGATGACCAGAAA
CTTCGAGCATTTTTTGACAAGAGGATCTCTCAAGAAGTCAATGGAGATGC
TCTTGGCGAGGAGTTCAAGGGATATGTGTTCAAGATTATGGGTGGCTGCG
ACAAGCAAGGTTTTCCCATGAAGCAAGGAGTGCTGACTCCCGGCCGTGTT
CGTCTTCTGCTCCACCGTGGTACCCCTTGCTTCCGTGGGTATGGCAGGAG
AGATGGAGAGCGCAGGAGGAAGTCTGTTCGTGGATGCATAGTTAGTCCAG
ATCTCTCCGTGTTGAATTTGGTCATTGTGAAAAAGGGAGAACATGACCTT
CCTGGACTTACCGATACAGAAAAGCCCAGAATGAGAGGTCCCAAGAGAGC
ATCGAAGATCAGGAAGTTGTTCAACCTTTCCAAGGAGGATGATGTTAGGA
AGTACGTTAACACCTATCGTAGGACCTTCACAACAAAATCTGGTAAGAAG
GTTAGCAAGGCACCGAAAATTCAGAGGTTGGTAACTCCTTTGACTCTGCA
AAGGAAGCGTGGCAGAATTGCAGAAAAGAAGCAGAGAATTG
back to top