FC931100

Overview
NameFC931100
Unique NameFC931100
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:1..712. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 1.027e-96
Identity = 182/213 (85.45%), Postives = 192/213 (90.14%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLQIGYQ 709
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REALE+SSQQEYLKLKARYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EAN+TLKQRLMEG  +N LQ   +A+D GYG +  Q QGD FFH LECEPTLQIGYQ
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQ 219          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.756e-88
Identity = 171/217 (78.80%), Postives = 190/217 (87.56%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREA--LELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGL-KPAQPQGDTFFHA--LECEPTLQIGY 706
            LKR+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+SSMLKTLERYQKCNYGAPE NV+++EA  LELSSQQEYLKLKARYE+LQRSQRNL+GE+LGPL+SK+LE+LERQLD SLKQIRSTRTQ+MLD L +LQ KE LL EAN+ L+QR MEGYQ+N+LQLN SAED GYG        GD  F    +ECEPTLQIGY
Sbjct:    8 LKRVENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSSMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQRSQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRALRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGY 223          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 8.159e-86
Identity = 169/218 (77.52%), Postives = 187/218 (85.78%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCG-YGLKPAQPQ--GDTFFHALECEPTLQIGYQ 709
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSML+TLERYQKCNYGAPEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELESLERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ E+   YG    Q Q     FF  LECEP LQIGYQ
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQ 224          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: AGL9_SOLLC (Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.161e-84
Identity = 156/173 (90.17%), Postives = 163/173 (94.22%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN 589
            LKRIE KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REALE+SSQQEYLKLK RYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+ Q KE  L+EAN+TLKQRLMEG Q+N
Sbjct:    8 LKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALEISSQQEYLKLKGRYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQRLMEGSQLN 180          

HSP 2 Score: 29.261 bits (64), Expect = 1.161e-84
Identity = 15/31 (48.39%), Postives = 18/31 (58.06%), Query Frame = 3
Query:  609 VQKIVVMGLNQLNLRAIPSFTPWNVNPHCKL 701
            + K+  M   QL LRA+ SF  W VN  CKL
Sbjct:  186 MHKLWAMAGKQLKLRAMASFILWIVNLLCKL 216          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.010e-84
Identity = 166/220 (75.45%), Postives = 187/220 (85.00%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED--CGYGLKPAQPQGDT---FFHALECEPTLQIGYQ 709
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSM++TLERYQKCNYG PEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELE LERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ ED    YG    Q Q ++   FF  LECEP LQ+GYQ
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKTLRLRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMGYQ 226          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 3.547e-81
Identity = 159/214 (74.30%), Postives = 177/214 (82.71%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPS-AEDCGYGLKPAQPQGDTFFHALECEPTLQIGY 706
            LK IENKINRQVTFAKRR  LLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS+SMLKTLE+YQKCN+G+PE  + +RE    SSQQEYLKLK R EALQRSQRNLLGE+LGPL SKELE LERQLD SL+QIRSTRTQ+MLD L +LQ +EQ+L EANKTLK+R  E  Q N  Q+ +PS     GYG +PAQ  G+ F+H LECEPTLQIGY
Sbjct:    8 LKMIENKINRQVTFAKRRKRLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRET--QSSQQEYLKLKNRVEALQRSQRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRFEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEPTLQIGY 219          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: SEP1_ARATH (Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2)

HSP 1 Score: 265.388 bits (677), Expect = 2.157e-70
Identity = 144/218 (66.06%), Postives = 167/218 (76.61%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSA------EDCGYGLKPAQPQGDTFFHALECEPTLQIGY 706
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS+MLKTL+RYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+RS +TQYMLD L++LQ+KEQ+L E N+ L  +L +   V +  +          ++  Y    AQ QG   +  LEC PTLQ+GY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQG--LYQPLECNPTLQMGY 222          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: SEP2_ARATH (Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.071e-69
Identity = 142/217 (65.44%), Postives = 166/217 (76.50%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAE-----DCGYGLKPAQPQGDTFFHALECEPTLQIGY 706
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LI+FSNRGKLYEFCS+S+MLKTLERYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+R  +TQYMLD L++LQ KE +L +AN+ L  +L +   V    +    E     +  YG   A  QG   + +LEC+PTLQIGY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQG--LYQSLECDPTLQIGY 221          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 259.996 bits (663), Expect = 9.063e-69
Identity = 143/220 (65.00%), Postives = 169/220 (76.82%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--EPTLQIGY 706
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EPTLQIGY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY 227          
BLAST of FC931100 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 259.996 bits (663), Expect = 9.063e-69
Identity = 143/220 (65.00%), Postives = 169/220 (76.82%), Query Frame = 2
Query:   71 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--EPTLQIGY 706
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EPTLQIGY
Sbjct:    8 LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY 227          
The following BLAST results are available for this feature:
BLAST of FC931100 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AGL9_PETHY1.027e-9685.45Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
MTF1_PEA1.756e-8878.80MADS-box transcription factor 1 OS=Pisum sativum G... [more]
SEP3_ARATH8.159e-8677.52Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SOLLC1.161e-8490.17Agamous-like MADS-box protein AGL9 homolog OS=Sola... [more]
AGL9_SINAL2.010e-8475.45Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_ARADE3.547e-8174.30Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
SEP1_ARATH2.157e-7066.06Developmental protein SEPALLATA 1 OS=Arabidopsis t... [more]
SEP2_ARATH1.071e-6965.44Developmental protein SEPALLATA 2 OS=Arabidopsis t... [more]
MADS7_ORYSJ9.063e-6965.00MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS7_ORYSI9.063e-6965.00MADS-box transcription factor 7 OS=Oryza sativa su... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101D10EF PostHarvP1 Citrus clementina cDNA clone C34101D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931100 ID=FC931100|Name=FC931100|organism=Citrus clementina|type=EST|length=712bp
GGAGATATATGAATATATAGTCATAGAAGAAGAAAGAAAGGAGAAGAAAA
TGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGATCAACAGG
CAAGTGACCTTTGCAAAGAGAAGAAATGGCCTTTTGAAGAAAGCTTATGA
GCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTTCTCCAATA
GAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCAAAACGCTT
GAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAATGTGTCCGC
AAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAAGCTTAAAG
CACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTGGAGAAGAA
CTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGGCAGCTTGA
TATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACATGCTGGATA
CCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAGCAAATAAG
ACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACACTTCAATT
GAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGCTCAACCTC
AGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACATTGCAAATT
GGATACCAGCCT
back to top