FC931102

Overview
NameFC931102
Unique NameFC931102
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15275 contig Ccv1_Contig15275:1..714. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: R13L1_ARATH (Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.750e-47
Identity = 99/224 (44.20%), Postives = 143/224 (63.84%), Query Frame = 2
Query:    8 KTLGGLLRGKHDRREWEDVLSSKIWELPQERCRIIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQQSSNSISRFVMHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLRHLSYIRGDYDGVKRFEDLCDIQHLRTLLPVTLLSSWPGFLAPSILTE--LFKLQRLRVFSLRGYHISELP 673
            KTLGG+LR +    EWE VLSS+IW+LP ++  ++P L VSYYYLP  LK+CFAYCS+FPK + FE ++++LLW A GFL    S    E+LG ++F EL +RS  Q++    +R++MHD +N+LAQ+A+GE   + E   ++      S   R+LSY+R +Y     FE L +++ LRT LP++L +S        +++E  L  L RLRV SL  Y I+ LP
Sbjct:  378 KTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTK---TRYIMHDFINELAQFASGEFSSKFEDGCKL----QVSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLP 594          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: RGA1_SOLBU (Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 5.194e-32
Identity = 86/231 (37.23%), Postives = 128/231 (55.41%), Query Frame = 2
Query:    5 SKTLGGLLRGKHDRREWEDVLSSKIWELPQERCRIIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQ--QSSNSISRFVMHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLRHLSYIRGDYDGVKRFEDLCDIQHLRTLLPVTLLSSWPGFLAPSILTELFKLQRLRVFSLRGYHISELPDSVGDL 691
            +KTLGG+LR K + REWE V  S IW LPQ+   I+PAL +SY++LP  L+QCF YC++FPKD +   E +I  W A GFL   +     ED+G + + EL  RSFFQ  +  +  + F MHDL++DLA              + +    + S N+R    I  +YDG           ++ ++    ++SS+    +PS+L    K   LRV +LR  ++++LP S+GDL
Sbjct:  353 AKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFL-LSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLA--------------TSLFSANTSSSNIRE---INANYDG-----------YMMSIGFAEVVSSY----SPSLLQ---KFVSLRVLNLRNSNLNQLPSSIGDL 547          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: DRL21_ARATH (Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.578e-31
Identity = 78/200 (39.00%), Postives = 110/200 (55.00%), Query Frame = 2
Query:  107 IIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQQSSNSISRFVMHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLRHLSYIRGDYDGVKRFEDLCDIQHLRTLLPVTLLSSWPGF-LAPSILTELFK-LQRLRVFSLRGYHISELPDSVGDLRCL 700
            I+P L +SY  LPP LK+CFA CS+FPK + F+ EE++LLW A   L    S    ED+G  +  +L A+SFFQ+   +++ FVMHDL+NDLA+  +G+  FR+    E +         RH S+ R   D    F  +C  + LRT+LP    +S     L   +L  L   L  LR+ SL  Y I+ LP S+  L+ L
Sbjct:  403 ILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRL----EDDNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLL 598          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: RGA3_SOLBU (Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 2.182e-30
Identity = 86/234 (36.75%), Postives = 129/234 (55.13%), Query Frame = 2
Query:    5 SKTLGGLLRGKHDRREWEDVLSSKIWELPQERCRIIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQ--QSSNSISRFVMHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLRHLSYIRGDYDG---VKRFEDLCDIQHLRTLLPVTLLSSWPGFLAPSILTELFKLQRLRVFSLRGYHISELPDSVGDL 691
            +KTLGGLLR K +  EWE V  S+IW LPQ+   ++PAL +SY++LP  L+QCFAYC++FPKD + E E +I LW A  FL   +     ED+G + + EL  RSFFQ  +  +  + F MHDL++DLA              + +    + SR++R ++ ++ D D    V  ++D+  I          ++SS+    +PS+     +   LRV +L      +LP SVGDL
Sbjct:  353 AKTLGGLLRFKREESEWEHVRDSEIWNLPQDENSVLPALRLSYHHLPLDLRQCFAYCAVFPKDTKIEKEYLIALWMAHSFL-LSKGNMELEDVGNEVWNELYLRSFFQEIEVKSGKTYFKMHDLIHDLA--------------TSMFSASASSRSIRQIN-VKDDEDMMFIVTNYKDMMSIGFSE------VVSSY----SPSLFK---RFVSLRVLNLSNSEFEQLPSSVGDL 557          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: RGA4_SOLBU (Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 82/231 (35.50%), Postives = 126/231 (54.55%), Query Frame = 2
Query:    5 SKTLGGLLRGKHDRREWEDVLSSKIWELPQERCRIIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQ--QSSNSISRFVMHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLRHLSYIRGDYDGVKRFEDLCDIQHLRTLLPVTLLSSWPGFLAPSILTELFKLQRLRVFSLRGYHISELPDSVGDL 691
            +KTLGGLLR K +  EWE V  ++IW LPQ+   I+PAL +SY++LP  L+QCFAYC++FPKD +   E +I LW A GFL   +     ED+G + + EL  RSFFQ  ++ +  + F +HDL++DLA              + +    +   N+R +              ++ D +H  ++    ++SS+    +PS+L    K   LRV +L    + +LP S+GDL
Sbjct:  355 AKTLGGLLRFKREESEWEHVRDNEIWSLPQDESSILPALRLSYHHLPLDLRQCFAYCAVFPKDTKMIKENLITLWMAHGFL-LSKGNLELEDVGNEVWNELYLRSFFQEIEAKSGNTYFKIHDLIHDLA--------------TSLFSASASCGNIREI--------------NVKDYKHTVSIGFAAVVSSY----SPSLLK---KFVSLRVLNLSYSKLEQLPSSIGDL 549          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: RGA2_SOLBU (Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.197e-28
Identity = 100/281 (35.59%), Postives = 136/281 (48.40%), Query Frame = 2
Query:    5 SKTLGGLLRGKHDRREWEDVLSSKIWELPQERCRIIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQ--QSSNSISRFVMHDLVNDLAQ--WAAG-----------EMYFRMEYI---------------------------SEVNKQQSFSRNLRHLSYIRGDYDGVKRF-EDLCDIQHLRT--LLPVTLLSSWPGFLAPSILTELFKLQRLRVFSLRG-YHISELPDSVGDLRCLGTL 709
            +KTLGG+L  K + R WE V  S IW LPQ+   I+PAL +SY+ LP  LKQCFAYC++FPKD + E E++I LW A GFL   +     ED+G + ++EL  RSFFQ  +  +  + F MHDL++DLA   ++A              Y  M  I                           S  NK  S   +L HL Y+     G++   + LC +Q+L+T  L   T L   P         E  KL  LR   L G   ++ +P  +G L CL TL
Sbjct:  354 AKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFL-LSKGNMELEDVGDEVWKELYLRSFFQEIEVKDGKTYFKMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLP--------KETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTL 625          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: DRL3_ARATH (Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.856e-13
Identity = 43/132 (32.58%), Postives = 65/132 (49.24%), Query Frame = 2
Query:   14 LGGLLRGKHDRREWEDV---LSSKIWELPQERCRIIPALAVSYYYLPPT-LKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQQSSNSISRFVMHDLVNDLAQWAA 397
            +G  +  +   +EW+ V   L+S   E P    +I+P L  SY  L    +K CF YCSLFP+DYE   EE+I  W   GF+D  E  + + + G      L  R+         ++  MHD++ ++A W A
Sbjct:  425 IGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFIDGNEDEDGANNKGHDIIGSL-VRAHLLMDGELTTKVKMHDVIREMALWIA 555          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: DRL28_ARATH (Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.400e-13
Identity = 65/251 (25.90%), Postives = 100/251 (39.84%), Query Frame = 2
Query:   11 TLGGLLRGKHDRREWEDVLSSKIWELPQ--ERCRIIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQQSSNSISRFVMHDLVNDLAQW---AAGEMYFRM-------------EYISEVNKQQSFSRNLRHLSYIRGDYDGVKRFEDLCDIQHLRTLLPVTLLSSWPGFLAPSILTELFKLQRLRVFSLRGYHISELPDSVGDLRCLGTL 709
            T+G  LRGK     W+  L+      P      +I   L +SY +L   +K CF +C+LFP+DY  +  E+I+ W A G LD         + G    + L+  S   +  +S     MHD+V D A W   + GE +  +             +++S V +    +  L  L       +GV+    L         +P   L ++P                LR+  L G  I  LPDS  +L  L +L
Sbjct:  314 TIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLK-DSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLP--NNVIEGVETLVLLLQGNSHVKEVPNGFLQAFP---------------NLRILDLSGVRIRTLPDSFSNLHSLRSL 546          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: R13L3_ARATH (Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.203e-12
Identity = 70/235 (29.79%), Postives = 104/235 (44.26%), Query Frame = 2
Query:   14 LGGLLRGKHDRREWEDVLSSKIWELPQERCRIIPALAVSYYYLPPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQQ---SSNSISRFVMHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLRHLSYIRGDYDGVKRFEDLCDIQHLRTLLPVTLLSSWPGFLAPSILTELFKLQRLRVFSLRGY-----HISE-LPDSVGDL 691
            L GLL  K    EW +V +S    L      I     +S+  +   LK CF Y S+FP+DYE + E++I L  A GF+   E     ED+ R +  EL  RS  +        +    +HDL+ DLA   A E+ F   Y  + +      R + H  ++  DY        LCD +  + +     +    GF    + T   KL+ LRV ++ G      +IS  LPD +G+L
Sbjct:  372 LSGLLSRKRTN-EWHEVCASLWRRLKDNSIHISTVFDLSFKEMRHELKLCFLYFSVFPEDYEIKVEKLIHLLVAEGFIQEDEE-MMMEDVARCYIDELVDRSLVKAERIERGKVMSCRIHDLLRDLAIKKAKELNFVNVYNEKQHSSDICRREVVH--HLMNDY-------YLCDRRVNKRMRSFLFIGERRGF--GYVNTTNLKLKLLRVLNMEGLLFVSKNISNTLPDVIGEL 593          
BLAST of FC931102 vs. ExPASy Swiss-Prot
Match: DRL1_ARATH (Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.571e-12
Identity = 46/135 (34.07%), Postives = 66/135 (48.89%), Query Frame = 2
Query:   14 LGGLLRGKHDRREWE---DVLSSKIWELPQERCRIIPALAVSYYYL-PPTLKQCFAYCSLFPKDYEFEDEEIILLWCASGFLDHGESGNPSEDLGRKFFQELRARSFFQQSSNSISRFVMHDLVNDLAQWAAGEM 406
            +G  +  K   +EW    DVLSS   E P    +I+P L  SY  L    +K CF YCSLFP+DY  E E +I  W   GF+D  ES   +   G +    L       + + +  +  MHD+V ++A W A ++
Sbjct:  358 IGETMACKRMVQEWRNAIDVLSSYAAEFPGME-QILPILKYSYDNLNKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDENESRERALSQGYEIIGILVRACLLLEEAINKEQVKMHDVVREMALWIASDL 491          
The following BLAST results are available for this feature:
BLAST of FC931102 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
R13L1_ARATH9.750e-4744.20Putative disease resistance RPP13-like protein 1 O... [more]
RGA1_SOLBU5.194e-3237.23Putative disease resistance protein RGA1 OS=Solanu... [more]
DRL21_ARATH2.578e-3139.00Putative disease resistance protein At3g14460 OS=A... [more]
RGA3_SOLBU2.182e-3036.75Putative disease resistance protein RGA3 OS=Solanu... [more]
RGA4_SOLBU1.847e-2935.50Putative disease resistance protein RGA4 OS=Solanu... [more]
RGA2_SOLBU1.197e-2835.59Disease resistance protein RGA2 OS=Solanum bulboca... [more]
DRL3_ARATH1.856e-1332.58Probable disease resistance protein At1g15890 OS=A... [more]
DRL28_ARATH5.400e-1325.90Probable disease resistance protein At4g27220 OS=A... [more]
R13L3_ARATH1.203e-1229.79Putative disease resistance RPP13-like protein 3 O... [more]
DRL1_ARATH1.571e-1234.07Probable disease resistance protein At1g12280 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101D12EF PostHarvP1 Citrus clementina cDNA clone C34101D12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931102 ID=FC931102|Name=FC931102|organism=Citrus clementina|type=EST|length=714bp
TGGCAGCAAAACGCTAGGAGGACTTTTACGTGGAAAACATGACAGACGTG
AGTGGGAAGATGTGCTCAGTAGCAAGATATGGGAATTACCACAAGAGAGA
TGTCGCATTATACCAGCCCTTGCAGTGAGCTATTATTATCTTCCTCCAAC
TTTGAAACAATGCTTTGCATACTGCTCATTGTTTCCAAAGGATTACGAAT
TTGAAGACGAGGAGATAATTTTATTATGGTGTGCTTCGGGTTTCTTGGAT
CACGGAGAGAGCGGGAATCCTAGTGAAGATCTAGGTCGAAAGTTCTTTCA
AGAGCTACGTGCAAGATCTTTTTTCCAGCAATCAAGCAATAGTATATCAC
GATTTGTGATGCACGACCTCGTCAATGACCTTGCTCAATGGGCTGCTGGG
GAAATGTACTTCAGAATGGAGTATATCTCAGAGGTTAACAAGCAGCAAAG
TTTTTCAAGAAATCTTCGTCATCTGTCGTACATTCGTGGAGATTACGATG
GTGTTAAAAGGTTTGAGGACTTGTGCGATATCCAACACTTGCGAACTCTT
TTACCAGTAACGTTGTTAAGTAGCTGGCCTGGATTCTTGGCTCCTAGCAT
TCTTACTGAGTTGTTCAAACTCCAACGATTGAGGGTCTTCTCTCTGCGTG
GATATCACATCTCCGAGCTGCCGGATTCAGTTGGTGATTTGAGGTGTTTA
GGCACCTTAACTGT
back to top