FC931103

Overview
NameFC931103
Unique NameFC931103
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15276 contig Ccv1_Contig15276:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP3_HUMAN (Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens GN=ENPP3 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 5.760e-36
Identity = 84/169 (49.70%), Postives = 106/169 (62.72%), Query Frame = 2
Query:  209 PVVILVSSDGFR--FGYQFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQFSPARHE---PKWWLGEPLWETVANQGLKAAAYFWAGSEVR-KGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            P VIL S DGFR  + Y + T  PNI++L   G  ++  +  ++PT TFPNHY+IVTGLYP SHGII+N   +      FS +  E   P WW G+P+W T   QGLKAA YFW GSEV   GS+  P  Y M YN SVPFE+R+ T+L + DLP  E P F  +YFE+
Sbjct:  159 PPVILFSMDGFRAEYLYTWDTLMPNINKLKTCGIHSKY-MRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNLNKNFSLSSKEQNNPAWWHGQPMWLTAMYQGLKAATYFWPGSEVAINGSF--PSIY-MPYNGSVPFEERISTLLKWLDLPKAERPRFYTMYFEE 323          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP3_PONAB (Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Pongo abelii GN=ENPP3 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.853e-34
Identity = 82/169 (48.52%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  209 PVVILVSSDGFRFGY--QFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQFSPARHE---PKWWLGEPLWETVANQGLKAAAYFWAGSEVR-KGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            P VIL S DGFR  Y   + T  PNI++L   G  ++  +  ++PT TFPNHY+IV GLYP SHGII+N   +      FS +  E   P WW G+P+W T   QGLKAA YFW GSE    GS+  P  Y M YN SVPFE+R+ T+L + DLP  E P F  +YFE+
Sbjct:  159 PPVILFSMDGFRAEYLHTWDTLMPNINKLKTCGIHSKY-MRAMYPTKTFPNHYTIVMGLYPESHGIIDNNMYDVNLNKNFSLSSKEQNNPAWWHGQPMWLTAMYQGLKAATYFWPGSEAAINGSF--PSIY-MPYNGSVPFEERISTLLKWLDLPKAERPRFYTMYFEE 323          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP3_RAT (Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus GN=Enpp3 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.017e-32
Identity = 77/171 (45.03%), Postives = 107/171 (62.57%), Query Frame = 2
Query:  203 ERPVVILVSSDGFRFGY--QFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQFSPA---RHEPKWWLGEPLWETVANQGLKAAAYFWAGSEVR-KGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            ++P VIL S DGFR  Y   + T  PNI++L   G  ++  +  ++PT TFPNHY+IVTGLYP SHGII+N   +      FS +   +  P WW G+P+W T   QGLKAA+Y+W GS+V   GS+  P  Y   Y++SVP+E R+ T+L + DLP  E P+F  +Y E+
Sbjct:  158 DQPPVILFSMDGFRAEYLQTWSTLLPNINKLKTCGLHSKY-MRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVYLNKNFSLSSVEKSNPAWWSGQPIWLTAMYQGLKAASYYWPGSDVAVNGSF--PNIY-RNYSNSVPYESRIATLLQWLDLPKAERPSFYTIYVEE 324          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP1_HUMAN (Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens GN=ENPP1 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 1.328e-32
Identity = 79/170 (46.47%), Postives = 100/170 (58.82%), Query Frame = 2
Query:  203 ERPVVILVSSDGFRFGY--QFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQF---SPARHEPKWWLGEPLWETVANQGLKAAAYFWAGSEVRKGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            E P  +L S DGFR  Y   +    P I +L   GT  +  + PV+PT TFPNHYSIVTGLYP SHGII+N+  +P+    F   S  +  P+W+ GEP+W T   QGLK+  +FW GS+V       P  Y M YN SVPFE+R+  VL +  LP DE P F  LY E+
Sbjct:  208 ETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKKCGTYTKN-MRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEWYKGEPIWVTAKYQGLKSGTFFWPGSDVEING-IFPDIYKM-YNGSVPFEERILAVLQWLQLPKDERPHFYTLYLEE 374          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP3_BOVIN (Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Bos taurus GN=ENPP3 PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.864e-32
Identity = 78/169 (46.15%), Postives = 101/169 (59.76%), Query Frame = 2
Query:  209 PVVILVSSDGFRFGY--QFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQFSPARHE---PKWWLGEPLWETVANQGLKAAAYFWAGSEVR-KGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            P VIL S DGFR  Y   + T  PNI++L   G  ++  L P +PT TFPNHY+IVTGLYP SHGII+N   +      FS +  E   P WW G+P+W T   QGLK   YFW GS+V   G++  P  Y + YN SV +E+R+ T+L + DLP  E P F  +Y E+
Sbjct:  159 PPVILFSMDGFRAEYLQTWSTLVPNINKLKTCGVHSQY-LRPAYPTKTFPNHYTIVTGLYPESHGIIDNNMYDINLNKNFSLSSKEKDNPAWWQGQPIWLTAMYQGLKVGTYFWPGSDVAINGTF--PSIYKI-YNRSVTYEERIFTLLKWLDLPKAERPDFYTIYVEE 323          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP3_MOUSE (Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Mus musculus GN=Enpp3 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.271e-31
Identity = 75/169 (44.38%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  209 PVVILVSSDGFRFGY--QFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQFSPA---RHEPKWWLGEPLWETVANQGLKAAAYFWAGSEVR-KGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            P VIL S DGFR  Y   + T  PNI++L   G  ++  +  ++PT TFPNHY+ VTGLYP SHGII+N   +      FS +   +  P WW G+P+W T   QGLKAA Y+W GS+V   GS+  P  Y   Y++SVP+E R+ T+L + DLP  + P+F  +Y E+
Sbjct:  159 PPVILFSMDGFRAEYLQTWSTLLPNINKLKTCGIHSKY-MRAMYPTKTFPNHYTSVTGLYPESHGIIDNNMYDVHLNKNFSLSSVEKSNPAWWSGQPIWLTAMYQGLKAACYYWPGSDVAVNGSF--PTIY-RNYSNSVPYERRITTLLQWLDLPKADRPSFYTIYVEE 323          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP1_MOUSE (Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus GN=Enpp1 PE=1 SV=4)

HSP 1 Score: 134.42 bits (337), Expect = 5.579e-31
Identity = 76/172 (44.19%), Postives = 101/172 (58.72%), Query Frame = 2
Query:  197 KLERPVVILVSSDGFRFGY--QFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQF---SPARHEPKWWLGEPLWETVANQGLKAAAYFWAGSEVRKGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            + E P  +L S DGFR  Y   +    P I +L N GT  +  + P++PT TFPNHYSIVTGLYP SHGII+N+  +P+    F   S  +  P W+ G+P+W T  +Q +K+  YFW GS+V       P  Y + YN SVPFE+R+  VL +  LPS E P F  LY E+
Sbjct:  188 EFESPPTLLFSLDGFRAEYLHTWGGLLPVISKLKNCGTYTKN-MRPMYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPLWYKGQPIWVTANHQEVKSGTYFWPGSDVEIDG-ILPDIYKV-YNGSVPFEERILAVLEWLQLPSHERPHFYTLYLEE 356          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP1_RAT (Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus GN=Enpp1 PE=2 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 9.517e-31
Identity = 76/172 (44.19%), Postives = 101/172 (58.72%), Query Frame = 2
Query:  197 KLERPVVILVSSDGFRFGY--QFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQF---SPARHEPKWWLGEPLWETVANQGLKAAAYFWAGSEVRKGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            + E P  +L S DGFR  Y   +    P I +L N GT  +  + PV+PT TFPNHYSIVTGLYP SHGII+N+  +P+    F   S  +  P W+ G+P+W T  +Q +++  YFW GS+V       P  Y + YN SVPFE+R+  VL +  LPS E P F  LY E+
Sbjct:  188 EFESPPTLLFSLDGFRAEYLHTWGGLLPVISKLKNCGTYTKN-MRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPLWYKGQPIWVTANHQEVRSGTYFWPGSDVEIDG-ILPDIYKV-YNGSVPFEERILAVLEWLQLPSYERPHFYTLYLEE 356          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: YGK5_SCHPO (Uncharacterized pyrophosphatase/phosphodiesterase C725.05c OS=Schizosaccharomyces pombe GN=SPBC725.05c PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 8.337e-27
Identity = 62/163 (38.04%), Postives = 87/163 (53.37%), Query Frame = 2
Query:  215 VILVSSDGFRFGYQFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQF----SPARHEPKWW-LGEPLWETVANQGLKAAAYFWAGSEVRKGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALY 688
            VI++S DGFR  Y ++  TPN+  L  +       LIP FP+ TFPNHY+IVTGLYP SHGI++N F +P TG QF         +P WW  GEP+W       +++A + W G+EV    +     Y   +N      ++ D +L + DLP  + P     Y
Sbjct:   76 VIVISLDGFRADYLYRGFTPNLLSLAERNVHVPF-LIPSFPSITFPNHYTIVTGLYPESHGIVSNNFFDPVTGKQFVNSMPECNKDPTWWDKGEPIWVNAERNNVRSAVHMWPGNEVENHGY--RPTYSDGFNFDTTLREKKDRILEWLDLPDKDRPQLLLAY 235          
BLAST of FC931103 vs. ExPASy Swiss-Prot
Match: ENPP4_XENLA (Ectonucleotide pyrophosphatase/phosphodiesterase family member 4 OS=Xenopus laevis GN=enpp4 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 6.606e-24
Identity = 64/164 (39.02%), Postives = 90/164 (54.88%), Query Frame = 2
Query:  209 PVVILVSSDGFRFGYQFKTPTPNIHRLINQGTEAETGLIPVFPTYTFPNHYSIVTGLYPASHGIINNRFVEPRTGDQFSPARHEPKWW-LGEPLWETVANQGLKAAAYFWAGSEVRKGSWDCPKGYCMKYNSSVPFEDRVDTVLSYFDLPSDEIPAFTALYFED 697
            P +IL+S DGFR  Y  + P PN+   + +G E E  +  VF T TFPNHYS+VTGLY  SHGI+ NR  +  T   F       KWW    P+W T   QG ++    W GS+V   +   P  + + YN +V F  RV+ + ++   P+D I  F A+Y+E+
Sbjct:   28 PKLILLSFDGFRADYLTRFPMPNLQEFMKEGVEVEE-VKNVFITKTFPNHYSLVTGLYAESHGIVANRMYDADTKQVFHMNDSHSKWWDEATPIWLTNQKQGHRSGCAMWPGSDVSIHN-TTPSDF-LYYNHTVSFAQRVNHITTWLTRPNDSI-NFAAIYWEE 187          
The following BLAST results are available for this feature:
BLAST of FC931103 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
ENPP3_HUMAN5.760e-3649.70Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP3_PONAB1.853e-3448.52Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP3_RAT1.017e-3245.03Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP1_HUMAN1.328e-3246.47Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP3_BOVIN3.864e-3246.15Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP3_MOUSE3.271e-3144.38Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP1_MOUSE5.579e-3144.19Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP1_RAT9.517e-3144.19Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
YGK5_SCHPO8.337e-2738.04Uncharacterized pyrophosphatase/phosphodiesterase ... [more]
ENPP4_XENLA6.606e-2439.02Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101E01EF PostHarvP1 Citrus clementina cDNA clone C34101E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931103 ID=FC931103|Name=FC931103|organism=Citrus clementina|type=EST|length=698bp
GAGCTCATCACAGAAACAAATTTTGGTCGTCATGGGTTCTGACCATCACG
CGTCGACATCACCATCAAATCAAACGAATCAATCCACAAGAACCCTCTTC
ATCATCACCCTTCTGCTCGTCACCTGCAATGCTGTTTCTGCAGCAGCATT
GCGCAATCCTTATATCAGAGCGAGAGCTCACGGCCCTGCCAAGAAGAAAC
TGGAGAGGCCGGTTGTTATCCTGGTTTCGTCGGACGGGTTTCGTTTCGGG
TACCAGTTCAAGACCCCAACGCCCAACATCCACCGCCTGATCAACCAGGG
GACCGAAGCAGAAACGGGTTTGATCCCCGTTTTCCCCACTTACACGTTCC
CTAATCATTACTCCATCGTGACGGGTCTCTACCCTGCTTCTCACGGCATC
ATCAATAACCGTTTCGTAGAACCTCGCACGGGCGATCAGTTTTCTCCGGC
ACGTCATGAGCCCAAGTGGTGGCTCGGCGAGCCGCTGTGGGAGACCGTGG
CCAATCAAGGGTTGAAGGCTGCTGCTTATTTCTGGGCCGGCTCGGAGGTT
CGCAAAGGTTCGTGGGATTGTCCAAAAGGTTACTGCATGAAATATAATTC
CTCTGTGCCTTTTGAAGATAGAGTTGATACTGTTTTGAGTTATTTCGATT
TGCCCAGCGACGAAATTCCTGCGTTTACTGCTCTATATTTTGAGGATC
back to top