FC931104

Overview
NameFC931104
Unique NameFC931104
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length724
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: AB39G_ARATH (ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 5.834e-87
Identity = 145/240 (60.42%), Postives = 187/240 (77.92%), Query Frame = 1
Query:    4 VGDLEGGNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGEFNSTV 723
            VG +  G K++GA+FFSL+N+MFNG+AEL+ TV+RLPVFYKQRD LFYP WAFALP W+L+IPLS+++S IWI LTYYTIGFAP+A+RFF+Q LAYFC++ MAL L+RF+ AIGRTEVI+N++GT               KDDI P++ W YY+SPMMYGQT+I+++EFLD RW  P+ D  IN +T+G+ LLK RGF+ + YW+WI I AL+GFS LFN  +I AL YLNP+G   +TV
Sbjct:  571 VGTVRDGQKFYGAMFFSLINVMFNGLAELAFTVMRLPVFYKQRDFLFYPPWAFALPAWLLKIPLSLIESGIWIGLTYYTIGFAPSAARFFRQLLAYFCVNQMALSLFRFLGAIGRTEVISNSIGTFTLLIVFTLGGFIIAKDDIRPWMTWAYYMSPMMYGQTAIVMNEFLDERWSSPNYDTRINAKTVGEVLLKSRGFFTEPYWFWICIVALLGFSLLFNLFYILALMYLNPLGNSKATV 810          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: AB34G_ARATH (ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 7.132e-85
Identity = 143/239 (59.83%), Postives = 185/239 (77.41%), Query Frame = 1
Query:    4 VGDLEGGNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGEFNST 720
            VG ++ G K++GALFFSL+N+MFNGMAEL+ TV+RLPVF+KQRD LFYP WAFALP ++L+IPLS+++S IWI LTYYTIGFAP+A+RFF+Q LAYFC++ MAL L+RF+ A+GRTEVI N+ GT               KDDI  +L W YY SPMMYGQT+++++EFLD RW  P+ D  IN +T+G+ LLK RGF+ + YW+WI IGAL+GF+ LFNF +I AL YLNP+G   +T
Sbjct:  569 VGTVQDGQKFYGALFFSLINLMFNGMAELAFTVMRLPVFFKQRDFLFYPPWAFALPGFLLKIPLSLIESVIWIALTYYTIGFAPSAARFFRQLLAYFCVNQMALSLFRFLGALGRTEVIANSGGTLALLVVFVLGGFIISKDDIPSWLTWCYYTSPMMYGQTALVINEFLDERWGSPNNDTRINAKTVGEVLLKSRGFFTEPYWFWICIGALLGFTVLFNFCYIIALMYLNPLGNSKAT 807          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: PDR2_NICPL (Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 8.718e-83
Identity = 144/234 (61.54%), Postives = 178/234 (76.07%), Query Frame = 1
Query:    7 GDLEGGNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGE 708
            G ++   K++GALFFSL+N+MFNGM EL+MTV RLPVF+KQR+ LFYPAWAFALPIWVL+IP+S+++S IWI+LTYYTIGFAPAASRFFKQ LA+  +H MAL L+RFIAA GRT+V+ N LGT               KDDI+ ++ WGYY+SPMMYGQ +I ++EFLD RW  P+     ++ T+GK LL  RG +    WYWI IGAL GFS LFN LFIAALT+LNPIG+
Sbjct:  569 GTVKDSAKFWGALFFSLINVMFNGMQELAMTVFRLPVFFKQRNSLFYPAWAFALPIWVLKIPISLVESAIWIILTYYTIGFAPAASRFFKQLLAFIGVHQMALSLFRFIAAAGRTQVVANTLGTFTLLMVFILGGFIVSKDDIQDWMIWGYYLSPMMYGQNAIAINEFLDDRWSAPTNG---SQPTVGKTLLHARGLFTTESWYWISIGALFGFSLLFNVLFIAALTFLNPIGD 799          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: PDR5_ORYSJ (Pleiotropic drug resistance protein 5 OS=Oryza sativa subsp. japonica GN=PDR5 PE=2 SV=2)

HSP 1 Score: 252.677 bits (644), Expect = 1.494e-66
Identity = 114/233 (48.93%), Postives = 160/233 (68.67%), Query Frame = 1
Query:   25 NKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGEFNSTV 723
            +KY GAL  SL+ IMFNG  EL +T+ +LP+FYKQRD LF+PAW + L   +L++PLS+++S++WIVLTYY +GFAPAA RFFKQ+LAYF  H MAL L+R + AI R+ V+ N  G                + DI+P+  WGY+ SPMMY   ++ V+EFL  RW +P+ D SI+  T+GKA L+ +G++   + YW+ IGA+IGF  +FN L++ ALT+L PIG  ++ V
Sbjct:  574 SKYVGALTASLITIMFNGFGELQLTIDKLPIFYKQRDFLFFPAWTYGLANIILKVPLSLMESSLWIVLTYYVVGFAPAAGRFFKQFLAYFWTHQMALALFRLLGAILRSMVVANTFGMFVLLLIFLFGGFLVSRKDIKPWWIWGYWTSPMMYSNNALSVNEFLASRWAIPNNDSSISAPTIGKAFLQSKGYFTGEWGYWLSIGAMIGFMIVFNILYLCALTFLRPIGSASTVV 806          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: PDR1_TOBAC (Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.875e-63
Identity = 108/230 (46.96%), Postives = 159/230 (69.13%), Query Frame = 1
Query:   16 EGGNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWD--VPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNP 699
            + G  Y GALFF ++ IMFNGM+EL+MT+ +LPVFYKQRD LF+P+WA+A+P W+L+IP+++++  +W++LTYY IGF P  +RF KQ+L    ++ MA  ++RFI A+GRT  + +  G+               +DD++ +  WGY++SPMMY   SILV+EF   +W+  VP G+      TLG  ++K RGF+ ++YWYWIG+GAL+GF+ +FNF +  AL YLNP
Sbjct:  561 DDGGIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYAIPSWILKIPVTLVEVGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAVGRTMGVASTFGSFALLLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKKWNHIVPGGN-----ETLGSTVVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNP 785          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: AB40G_ARATH (ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.655e-60
Identity = 109/229 (47.60%), Postives = 148/229 (64.63%), Query Frame = 1
Query:   22 GNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGE 708
            G+ Y GALFF L+ +MFNGM+ELSMT+ +LPVFYKQRD LFYPAW ++LP W+L+IP+S +++ +   +TYY IGF P   R FKQY+    ++ MA  L++ +AA+GR  ++ N  G                +DDI+ +  WGY++SP+MYGQ +IL +EF    W     + S    TLG   LK RGF   +YWYWIG GAL+GF  LFNF F  ALT+LN +G+
Sbjct:  556 GSLYTGALFFILMMLMFNGMSELSMTIAKLPVFYKQRDLLFYPAWVYSLPPWLLKIPISFMEAALTTFITYYVIGFDPNVGRLFKQYILLVLMNQMASALFKMVAALGRNMIVANTFGAFAMLVFFALGGVVLSRDDIKKWWIWGYWISPIMYGQNAILANEFFGHSWSRAVENSS---ETLGVTFLKSRGFLPHAYWYWIGTGALLGFVVLFNFGFTLALTFLNSLGK 781          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: AB32G_ARATH (ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.354e-59
Identity = 103/237 (43.46%), Postives = 153/237 (64.56%), Query Frame = 1
Query:   13 LEGGNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGEFNSTV 723
            ++ GN Y G+L+FS++ I+FNG  E+ M V +LPV YK RD  FYP+WA+ LP W+L IP SI++S  W+ +TYYTIG+ P  SRF +Q+L YF +H M+L L+R + ++GR  ++ N  G+               +D I  +  WGY++SP+MY Q +  V+EFL   W   +G+ + +  +LG ALLK R  ++ +YWYWIG+ AL+G++ LFN LF   L +LNP G+F + V
Sbjct:  534 IDDGNIYLGSLYFSMVIILFNGFTEVPMLVAKLPVLYKHRDLHFYPSWAYTLPSWLLSIPTSIIESATWVAVTYYTIGYDPLFSRFLQQFLLYFSLHQMSLGLFRVMGSLGRHMIVANTFGSFAMLVVMTLGGFIISRDSIPSWWIWGYWISPLMYAQNAASVNEFLGHNWQKTAGNHTSD--SLGLALLKERSLFSGNYWYWIGVAALLGYTVLFNILFTLFLAHLNPWGKFQAVV 768          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: PDR1_NICPL (Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.017e-59
Identity = 106/237 (44.73%), Postives = 153/237 (64.56%), Query Frame = 1
Query:   16 EGGNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRW-DVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGEFNSTV 723
            E G  Y GALFF ++ IMFNG++EL MT+ +LPVFYKQRD LFYP+WA+A+P W+L+IP++  +  +W+ LTYY +GF P   RFFKQ+L    ++ MA  L+RFIAA+GRT  + +  G                ++D++ +  WGY+ SP+MY   +ILV+EF   +W  + +G        LG A+++ RGF+ D+YWYWIG+GAL GF  +FN  +  AL YLNP  +  +T+
Sbjct:  565 EDGGIYSGALFFVVIMIMFNGLSELPMTLYKLPVFYKQRDFLFYPSWAYAIPSWILKIPVTFAEVGMWVFLTYYVMGFDPNVGRFFKQFLLLLLVNQMASALFRFIAAVGRTMGVASTFGAFALLLQFALGGFILARNDVKDWWIWGYWTSPLMYSVNAILVNEFDGQKWKHIVAG----GTEPLGAAVVRARGFFPDAYWYWIGVGALAGFIVMFNIAYSVALAYLNPFDKPQATI 797          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: AB31G_ARATH (ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 5.147e-59
Identity = 105/234 (44.87%), Postives = 153/234 (65.38%), Query Frame = 1
Query:   22 GNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGEFNSTV 723
            GN+Y   LFF L+++MFNG +EL + + RLPVFYKQRD+ F+PAW++++  W+LR+P S+L++ +W  + Y+T+G AP+A RFF+  L  F +H MAL L+R +A++ R  VI N  G+               K DI+P+  WG++VSP+ YGQ +I V+EF   RW  PS   +I++ T+G  LLK R F  + YWYWIGI  LIG++ LFN +   AL YLNP+ +  + V
Sbjct:  563 GNEYLSCLFFGLVHMMFNGFSELPLMISRLPVFYKQRDNSFHPAWSWSIASWLLRVPYSVLEAVVWSGVVYFTVGLAPSAGRFFRYMLLLFSVHQMALGLFRMMASLARDMVIANTFGSAAILIVFLLGGFVIPKADIKPWWVWGFWVSPLSYGQRAIAVNEFTATRWMTPS---AISDTTIGLNLLKLRSFPTNDYWYWIGIAVLIGYAILFNNVVTLALAYLNPLRKARAVV 793          
BLAST of FC931104 vs. ExPASy Swiss-Prot
Match: TUR2_SPIPO (Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 9.706e-58
Identity = 106/237 (44.73%), Postives = 148/237 (62.45%), Query Frame = 1
Query:   13 LEGGNKYFGALFFSLLNIMFNGMAELSMTVLRLPVFYKQRDHLFYPAWAFALPIWVLRIPLSILDSTIWIVLTYYTIGFAPAASRFFKQYLAYFCIHNMALPLYRFIAAIGRTEVITNALGTXXXXXXXXXXXXXXXKDDIEPFLEWGYYVSPMMYGQTSILVDEFLDGRWDVPSGDRSINERTLGKALLKRRGFYNDSYWYWIGIGALIGFSFLFNFLFIAALTYLNPIGEFNSTV 723
            LE    +FGA+F  L+  +FNG AEL+M++ +LPVFYKQRD LFYP WA+ALP W+L+IP+S ++  +WI +TYY IGF P   R F+ YL    I  +A  L+R +AA+GR  V+ +  G                ++ I+ F  WGY+ SP+MY Q +I V+EFL   W+          +TLG+  L+ RG + D  WYWIG+GALIG+  LFNFLFI  L +L+P+G+  +TV
Sbjct:  556 LEDATIFFGAMFLGLVTHLFNGFAELAMSIAKLPVFYKQRDLLFYPPWAYALPTWILKIPISFVECGVWIAMTYYVIGFDPNVVRMFRHYLLLVLISQVASGLFRLLAAVGRDMVVADTFGAFAQLVLLVLGGFIIAREKIKKFWIWGYWSSPLMYAQNAIAVNEFLGHSWNKLV---DATGQTLGERFLRNRGIFVDKNWYWIGVGALIGYMVLFNFLFILFLEWLDPLGKGQTTV 789          
The following BLAST results are available for this feature:
BLAST of FC931104 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
AB39G_ARATH5.834e-8760.42ABC transporter G family member 39 OS=Arabidopsis ... [more]
AB34G_ARATH7.132e-8559.83ABC transporter G family member 34 OS=Arabidopsis ... [more]
PDR2_NICPL8.718e-8361.54Pleiotropic drug resistance protein 2 OS=Nicotiana... [more]
PDR5_ORYSJ1.494e-6648.93Pleiotropic drug resistance protein 5 OS=Oryza sat... [more]
PDR1_TOBAC5.875e-6346.96Pleiotropic drug resistance protein 1 OS=Nicotiana... [more]
AB40G_ARATH4.655e-6047.60ABC transporter G family member 40 OS=Arabidopsis ... [more]
AB32G_ARATH1.354e-5943.46ABC transporter G family member 32 OS=Arabidopsis ... [more]
PDR1_NICPL3.017e-5944.73Pleiotropic drug resistance protein 1 OS=Nicotiana... [more]
AB31G_ARATH5.147e-5944.87ABC transporter G family member 31 OS=Arabidopsis ... [more]
TUR2_SPIPO9.706e-5844.73Pleiotropic drug resistance protein TUR2 OS=Spirod... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101E02EF PostHarvP1 Citrus clementina cDNA clone C34101E02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931104 ID=FC931104|Name=FC931104|organism=Citrus clementina|type=EST|length=724bp
TCAGTGGGAGATCTGGAAGGTGGCAATAAGTATTTCGGAGCACTGTTTTT
CAGTCTGCTTAATATTATGTTTAACGGGATGGCAGAACTTTCAATGACTG
TTTTGAGGCTACCTGTATTTTATAAACAAAGGGATCACTTATTCTATCCT
GCGTGGGCTTTTGCCTTACCTATATGGGTTCTCCGGATCCCATTATCAAT
CCTGGATTCAACAATATGGATCGTTCTGACCTACTACACAATAGGTTTTG
CTCCAGCAGCAAGCAGGTTCTTCAAACAATACTTGGCATACTTTTGTATA
CACAATATGGCTCTGCCCCTTTACCGGTTCATTGCTGCTATTGGAAGAAC
TGAGGTTATTACAAACGCACTGGGTACTTTCGCCTTGTTACTCATTTTTT
CACTCGGAGGATTCATCATTGCCAAAGATGACATTGAGCCATTCCTGGAA
TGGGGCTACTATGTTTCGCCTATGATGTATGGACAGACTTCCATACTTGT
AGATGAATTCCTTGATGGAAGATGGGATGTGCCCAGTGGAGACCGCAGCA
TTAATGAACGTACACTTGGGAAAGCACTTCTCAAGAGGAGAGGCTTCTAC
AATGACAGTTACTGGTATTGGATTGGCATCGGAGCACTGATTGGATTTTC
TTTTCTCTTCAACTTTTTGTTTATTGCAGCATTGACTTACTTGAATCCTA
TCGGTGAATTCAACTCAACTGTCG
back to top