FC931106

Overview
NameFC931106
Unique NameFC931106
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931106_ssr144 microsatellite FC931106_ssr144:144..155. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14618 contig Ccv1_Contig14618:54..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931106 vs. ExPASy Swiss-Prot
Match: PR1A1_ARATH (PRA1 family protein A1 OS=Arabidopsis thaliana GN=PRA1A1 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.817e-70
Identity = 130/179 (72.63%), Postives = 142/179 (79.33%), Query Frame = 2
Query:  176 MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSAKWNSRLKCNLYYYRTNYFIMITVILGLGFLRRPVXXXXXXXXXXXXXFLNDSFAGTFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLIFSCVSFILWYVSCGLLTVLWALAXGLLCTIL 712
            MDWGNVT +DL DALREVDWSSPPRP SEFFSRFTVP+S  KW+SRLKCNLYYYRTNYFIMI VILGLG L RP+             FLNDSFAG+F+EK TRTVR+FSP LAAKMRPPLTPV RGRPS+KRAI++CG+PRWVFVL  S VSF LWY+S GLL V  AL    L TIL
Sbjct:    1 MDWGNVTVDDLFDALREVDWSSPPRPPSEFFSRFTVPKSVPKWDSRLKCNLYYYRTNYFIMIVVILGLGVLTRPLAIFAALLTALSLAFLNDSFAGSFSEKATRTVRRFSPQLAAKMRPPLTPVTRGRPSSKRAIHVCGQPRWVFVLTCSLVSFALWYISSGLLRVSVALLIAHLATIL 179          
BLAST of FC931106 vs. ExPASy Swiss-Prot
Match: PR1A2_ARATH (PRA1 family protein A2 OS=Arabidopsis thaliana GN=PRA1A2 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.078e-61
Identity = 106/179 (59.22%), Postives = 131/179 (73.18%), Query Frame = 2
Query:  176 MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSAKWNSRLKCNLYYYRTNYFIMITVILGLGFLRRPVXXXXXXXXXXXXXFLNDSFAGTFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLIFSCVSFILWYVSCGLLTVLWALAXGLLCTIL 712
            MDW NV AED+I+ALREV+WS+PPR   EFFSRF  PRS +KW SRLKCNLYYYRTNYFI++  +LGL  + RP+             FLNDSFA +FNEK  RT+R FSPH+AAKMRPP  PVIRGR +A++ +Y+CG+PRWVFV+ F   S ++W+ SCGLL VL+AL   L   I+
Sbjct:    1 MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFILVIFVLGLALVTRPLALVGAALTALSIAFLNDSFAASFNEKFIRTIRHFSPHMAAKMRPPHMPVIRGRSTARKTVYVCGKPRWVFVITFLTASLVMWFSSCGLLWVLYALLTSLAVIIV 179          
BLAST of FC931106 vs. ExPASy Swiss-Prot
Match: PR1A3_ARATH (PRA1 family protein A3 OS=Arabidopsis thaliana GN=PRA1A3 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.643e-60
Identity = 109/179 (60.89%), Postives = 132/179 (73.74%), Query Frame = 2
Query:  176 MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSAKWNSRLKCNLYYYRTNYFIMITVILGLGFLRRPVXXXXXXXXXXXXXFLNDSFAGTFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLIFSCVSFILWYVSCGLLTVLWALAXGLLCTIL 712
            MDW +V AED+I+ALREV+WS+ PR L+EFFSRF  PRS +KW SRLKCNLYYYRTNYFI+   +LGL  + RP+             FLNDSFA TFNEK+ RT+R FSPHLAAKMRPP  PVIRGR + ++ +YICG+PR VFVL+    SF+LW+ SCGLL VL+AL   LL  +L
Sbjct:    1 MDWDSVAAEDVIEALREVEWSASPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFILFVFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPPHMPVIRGRSATRKTVYICGQPRLVFVLLGLTASFVLWFTSCGLLWVLYALTTALLMILL 179          
The following BLAST results are available for this feature:
BLAST of FC931106 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
PR1A1_ARATH2.817e-7072.63PRA1 family protein A1 OS=Arabidopsis thaliana GN=... [more]
PR1A2_ARATH4.078e-6159.22PRA1 family protein A2 OS=Arabidopsis thaliana GN=... [more]
PR1A3_ARATH2.643e-6060.89PRA1 family protein A3 OS=Arabidopsis thaliana GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101E05EF PostHarvP1 Citrus clementina cDNA clone C34101E05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931106 ID=FC931106|Name=FC931106|organism=Citrus clementina|type=EST|length=713bp
GATTCAATTTAATTCTCTTCATCACATCGCAGGAAACCCACAGCCACAGC
CTCGACTCTTTCTTAATCTGCCTAGGGTTTCGCGGATCATTTTATTTTGC
ACAAAATAAATCGTTTTCTAGGGTTTCGGAAGAGCGGAATATTATAATAA
TAATAACAATAGTAGTAATCAAGCGATGGATTGGGGAAACGTAACAGCAG
AAGATCTTATCGACGCGCTTCGTGAAGTTGACTGGTCGTCTCCACCGCGT
CCTCTCTCCGAGTTCTTCTCCAGGTTCACCGTTCCGAGATCCTCCGCCAA
ATGGAACAGCCGATTGAAATGCAATCTTTACTACTACCGAACAAACTACT
TTATCATGATTACTGTCATTCTTGGGTTGGGTTTCCTAAGGAGACCTGTT
GCTATTATTGCTGCTCTTTTGACAGCCCTTAGTATTGCATTTCTCAATGA
CAGCTTTGCAGGTACTTTCAATGAGAAGGTGACAAGAACTGTGAGGCAAT
TTTCTCCACATCTAGCTGCAAAGATGAGGCCTCCTCTTACACCTGTTATT
CGTGGGCGCCCATCAGCGAAAAGAGCAATCTATATATGTGGTCGGCCTCG
TTGGGTGTTCGTCTTAATATTTTCTTGCGTAAGTTTCATCCTTTGGTATG
TTTCCTGTGGTCTTTTGACTGTTCTATGGGCACTTGCTGNTGGACTTCTT
TGCACTATCCTTC
back to top