FC931135

Overview
NameFC931135
Unique NameFC931135
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931135_ssr393 microsatellite FC931135_ssr393:393..404. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig4683 contig Ccv1_Contig4683:512..1232. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931135 vs. ExPASy Swiss-Prot
Match: KING1_ARATH (SNF1-related protein kinase regulatory subunit gamma 1 OS=Arabidopsis thaliana GN=KING1 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 1.901e-13
Identity = 39/96 (40.62%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  103 EAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAE 390
            E +   +K   S  E L A F  IPV +FP     + IEI +DT++ +AV+ LS+  +LSAPV   DAP  + W +RY+GIV++  I++W+L   E
Sbjct:   33 EDLWDEQKPQLSPNEKLNACFESIPVSAFPLSSDSQDIEIRSDTSLAEAVQTLSKFKVLSAPVVDVDAPEDASWIDRYIGIVEFPGIVVWLLHQLE 128          
The following BLAST results are available for this feature:
BLAST of FC931135 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
KING1_ARATH1.901e-1340.63SNF1-related protein kinase regulatory subunit gam... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34101H02EF PostHarvP1 Citrus clementina cDNA clone C34101H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931135 ID=FC931135|Name=FC931135|organism=Citrus clementina|type=EST|length=721bp
GGACCCAATCAAGATTCTTAACCCAAGTTTCTACGAACAGGCATGGCTCA
AGCAGAAGAGGCCAAGGAAGTTTCAAAACTTTCTAGCTGTGATGCTTATT
TTGAGGCCATACAGTCGAGGAAAAAATTACCGCATTCATTACAGGAGACT
TTAACAGCTGCATTTGCAAGGATTCCAGTTCTATCTTTCCCAAATGTTCC
AGGAGGCAGAGTGATTGAAATTATGGCAGACACAACCATTCCTGATGCTG
TGAAGATTCTATCAGAATGCAACATTTTGTCTGCTCCTGTGAAAATCCCA
GACGCACCATCTAGTTCGGATTGGAAGGAAAGGTACCTAGGGATTGTAGA
TTACTCAGCAATCATTCTTTGGGTGTTAGAGACTGCAGAACTTGCTGCTG
CTGCCTTCTCAGTGGGCACTGCAACAGCTGCTGGTGTAGGTACTGGAACA
GTTGGTGCTCTTGGAGCACTAGCATTGGGCATGACAGGTCCTGCTGCAGT
TGCTGGGCTAACTGTTGCTGCAGCAGGTGCTGCTGTGGCTGGTGGTCTAG
CTGCAGAAAAAGGGGCAGGAAAAGATGCTCCCACGGCTGCTGATAGACTA
CATGAGGATTTTTACAAAGTTATCCTTCAAGAAGAACCTTTCAAGTCGGC
TACAGTGAGGTCAATAAATTAGTCCTATCGCTGGGCACCTTTCCTTCCAG
TTGCACAGATGGTTCTATGCT
back to top