FC931136

Overview
NameFC931136
Unique NameFC931136
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length686
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931136 vs. ExPASy Swiss-Prot
Match: ADAT3_RAT (tRNA-specific adenosine deaminase-like protein 3 OS=Rattus norvegicus GN=Adat3 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.562e-12
Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 1
Query:  547 ESARPYLCTGYDIYLVWEPCVMCAMALVHQRIRRIFYAFPNPHEA 681
            E + PY+CTGYD+Y+  EPCVMCAMALVH RI+R+FY  P+P  A
Sbjct:  270 EDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGA 314          
BLAST of FC931136 vs. ExPASy Swiss-Prot
Match: ADAT3_MOUSE (tRNA-specific adenosine deaminase-like protein 3 OS=Mus musculus GN=Adat3 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.562e-12
Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 1
Query:  547 ESARPYLCTGYDIYLVWEPCVMCAMALVHQRIRRIFYAFPNPHEA 681
            E + PY+CTGYD+Y+  EPCVMCAMALVH RI+R+FY  P+P  A
Sbjct:  270 EDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGA 314          
BLAST of FC931136 vs. ExPASy Swiss-Prot
Match: ADAT3_HUMAN (tRNA-specific adenosine deaminase-like protein 3 OS=Homo sapiens GN=ADAT3 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.633e-11
Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 1
Query:  547 ESARPYLCTGYDIYLVWEPCVMCAMALVHQRIRRIFYAFPNPHEA 681
            E   PYLCTGYD+Y+  EPC MCAMALVH RI R+FY  P+P  A
Sbjct:  272 EDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGA 316          
The following BLAST results are available for this feature:
BLAST of FC931136 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ADAT3_RAT9.562e-1264.44tRNA-specific adenosine deaminase-like protein 3 O... [more]
ADAT3_MOUSE9.562e-1264.44tRNA-specific adenosine deaminase-like protein 3 O... [more]
ADAT3_HUMAN3.633e-1164.44tRNA-specific adenosine deaminase-like protein 3 O... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34101H03EF PostHarvP1 Citrus clementina cDNA clone C34101H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931136 ID=FC931136|Name=FC931136|organism=Citrus clementina|type=EST|length=686bp
ATGAAATCTGCTGTTGAGTTGGCACAATCTGGTGATGGTTCGATTGTAAA
TGCTGCAGTTATAGTGGATCCTTCCATTAAGCAGGAGATTGCAAGCGCAT
GTGATCAAATCTGCTGTTGTTCCATTTCCACGGAGAAGAATAGCTTAGAG
AGCTGTTCAGAGCAGCCAGAAGTGCTTAGCTCTGACCTTTTTTCAAATGG
AGAATCAAACCATACATCTTTGCCTCCAAATGATTTTCCTAGTGAAACCA
GAAAATCGTATTCTGGTGTTTCGTGTTTGAACCCTTGGCAGTGGGCTCAG
GAAAACTCACATACGACCTCTTGTTATTGGCATCCTCTACGACATGCTGC
TATAGCTGCTATACAGTCTTCTGCTGCAAGGGACAGACTCTTGTTCCCTG
GTATGGGACATGAGGGAGATAAGCCCAATGGAGTTCATAATATACAGCCT
ACTTCCATAGGTACACCAGCAAAAAGACAAAAGACTGACCTTGCAAATGT
TGAGAACAGTGAGGAACTGGATCCTAGTGCTGGAGGTTTTCATCCAGAAT
CAGCCAGACCTTATCTATGCACTGGTTATGACATCTATTTAGTTTGGGAG
CCTTGTGTAATGTGTGCGATGGCGCTTGTTCATCAAAGAATAAGACGTAT
ATTTTATGCTTTCCCAAACCCCCATGAGGCGCATTG
back to top