FC931137

Overview
NameFC931137
Unique NameFC931137
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length657
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15189 contig Ccv1_Contig15189:67..723. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931137 vs. ExPASy Swiss-Prot
Match: PLZ12_LUPPO (Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.652e-24
Identity = 59/110 (53.64%), Postives = 71/110 (64.55%), Query Frame = 3
Query:  327 LNLDAAFEQKNEIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDVHVKRAMNXXXXXXXXXXXXXXXXXXXXXLQIKQAEGEAEAKYLSGLGIARQRQAIVDGLRDSVLAF 656
            +NLD  FEQK E+AK+V EELEK M  YGY I   L+VDI PD  V+RAMN                     LQ+K+AE EAEAKYL G+G+ARQRQAI DGLR+++L F
Sbjct:    1 MNLDDLFEQKGEVAKSVLEELEKVMGEYGYNIEHILMVDIIPDDSVRRAMNEINAAQRMQLASLYKGEAEKILQVKRAEAEAEAKYLGGVGVARQRQAITDGLRENILNF 110          
The following BLAST results are available for this feature:
BLAST of FC931137 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PLZ12_LUPPO2.652e-2453.64Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34101H04EF PostHarvP1 Citrus clementina cDNA clone C34101H04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931137 ID=FC931137|Name=FC931137|organism=Citrus clementina|type=EST|length=657bp
AAACGTTGGGCTGCATTCAGGTGGAGCAGTCAAAAGTAGTCATCAGAGAA
CAATTTGGAAAGTTTGATCATGTGCTTGAACCTCGGTGTCAATGCTTGCC
TTGGTGCCTTGGCTACAAGGTAGCTGGTCGGCTTTCACTCCGGGTGCAAC
AACTGGATGTTAAATGTGAAACAAAGACTAAGGATAATGTTTTTGTCAAT
GTGGTTGCTTCCGTTCAATATCGTGCCTTGGCTGATAAAGCTTATGATGC
TTTCTATAAGCTCTCCAACACCAGGGGCCAAATCCAAGCCTATGTCTTTG
ATGTTATCAGGGCAAGCATACCAAAACTGAACTTAGATGCCGCCTTTGAG
CAGAAGAATGAAATTGCCAAAGCCGTTGAAGAGGAGCTCGAAAAGGCCAT
GTCTCATTATGGGTATGAGATAGTGCAGACTCTTATTGTGGATATTGAGC
CAGATGTTCATGTAAAGAGAGCAATGAATGAGATCAATGCAGCTGCAAGA
CTGAGGCTGGCAGCAAATGAGAAGGCTGAGGCAGAGAAGATATTGCAAAT
CAAACAAGCTGAAGGGGAGGCTGAGGCAAAATACCTGTCCGGACTTGGGA
TAGCACGTCAGCGCCAGGCTATTGTTGATGGGTTAAGAGACAGTGTGCTT
GCCTTCT
back to top