FC931140

Overview
NameFC931140
Unique NameFC931140
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length726
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12734 contig Ccv1_Contig12734:92..817. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QORX_HUMAN (Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2)

HSP 1 Score: 206.838 bits (525), Expect = 9.401e-53
Identity = 106/234 (45.30%), Postives = 148/234 (63.25%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVS-RWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGR 716
            M A+   +PG PE L ++EV  P   + EVL+KV A+ALNRAD +QR+G Y PP GAS   GLE SG +  +G      WK+GD   ALL GGG A+ V VP G ++P+P G++L  AAA PE   T +  + +  ++  G+  L+H G SG+GT AIQ+ +  G    VTAGS++KL + + LGA    NYK EDF     + T G GV++ILDC+G SY+++N++ L +DGR
Sbjct:    1 MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGR 234          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_BOVIN (Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 3.144e-32
Identity = 87/239 (36.40%), Postives = 133/239 (55.65%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY-PGLECSGTILSVGKNVSRWKVGDQVCALLG-GGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M+AI + + G PEVL+LQ +V  P  KD +VLIKV+A  +N  DT  R G++   K   PY PG + +G I +VG++VS +K GD+V       GGYAE        V  +P  +  K  AA      T +  +  ++ + PGES LVHG S G+G  A Q+ +  G++V  TA +EE   +  + GA    N+K  D++ ++K+  G KGVDVI++ +       +L+ L+  GR+ +
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHNI-KPLLPYTPGFDVAGIIEAVGESVSAFKKGDRVFTTRTISGGYAEYALAADHTVYTLPEKLDFKQGAAIGIPYFTAYRALLHSACVKPGESVLVHGASGGVGIAACQIARAYGLKVLGTASTEEGQKIVLENGAHKVFNHKEADYIDKIKKSVGEKGVDVIIEMLANVNLSNDLNLLSHGGRVIV 245          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_RAT (Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.195e-31
Identity = 87/239 (36.40%), Postives = 126/239 (52.72%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY-PGLECSGTILSVGKNVSRWKVGDQV-CALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M+AI + + G PEVL+LQ +V  P  +  +VLIKV A  +N  +T  R G+Y   K A PY PG + +G I SVG  VS +K GD+V C     GGYAE          P+P  +  +  AA      T    +F ++    GES LVHG S G+G    Q+ +  G++V  TAGSEE   +    GA    N+K  +++ ++K   G KGVDVI++ +       +L  L+  GR+ +
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSR-KPALPYTPGSDVAGIIESVGDGVSAFKKGDRVFCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKTSAGDKGVDVIIEMLANKNLSNDLKLLSCGGRVIV 245          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_PONAB (Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.253e-30
Identity = 81/239 (33.89%), Postives = 130/239 (54.39%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY-PGLECSGTILSVGKNVSRWKVGDQV-CALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M+A+ + + G PEVL+LQ ++  P  KD + LIKV A  +N  +T  R G+Y   K   PY PG + +G I +VG N S +K GD+V  +    GGYAE        V  +P  +  K  AA      T +  +  ++H+  GES LVHG S G+G  A Q+ +  G++V  TAG+EE   +    GA    N++  +++ ++K+  G KG+DVI++ +      ++L  L+  G++ +
Sbjct:    8 MRAVRVFEFGGPEVLKLQSDIAVPIPKDHQALIKVHACGVNPVETYIRSGTYSR-KPLLPYTPGSDVAGVIEAVGGNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSAHVKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDVIIEMLANVNLNKDLSLLSHGGQVIV 245          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_MOUSE (Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.843e-30
Identity = 87/241 (36.10%), Postives = 128/241 (53.11%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY-PGLECSGTILSVGKNVSRWKVGDQV-CALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETG--GKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M+AI + + G PEVL+LQ +V  P  +  +VLIKV A  +N  +T  R G+Y   K A PY PG + +G I SVG  VS +K GD+V C     GGYAE        + P+P  ++ +  AA      T    +F ++    GES LVHG S G+G    Q+ +  G++V  TAGSEE   +    GA    N+K  +++ ++K   G   KGVDVI++ +       +L  L+  GR+ +
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSR-KPALPYTPGSDVAGIIESVGDKVSAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVV 247          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_CAVPO (Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.118e-29
Identity = 82/238 (34.45%), Postives = 123/238 (51.68%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLG-GGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M+AI + + G PEVL++Q +V  P  KD +VLIKV A  +N  +T  R G+Y         PG + +G + S+G +VS +K GD+V       GGYAE        V  +P  +  +  AA      T    +F ++    GES LVHG S G+G  A Q+ +  G++V  TAG+EE   V    GA    N++   ++  +K+  G KGVDVI++ +       +L  L+  GR+ I
Sbjct:    8 MRAIRVFEFGGPEVLKVQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTYTRIPLLPYTPGTDVAGVVESIGNDVSAFKKGDRVFTTSTISGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTACRALFHSARAKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQNGAHEVFNHRDAHYIDEIKKSIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVII 245          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_HUMAN (Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.907e-29
Identity = 79/239 (33.05%), Postives = 130/239 (54.39%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY-PGLECSGTILSVGKNVSRWKVGDQV-CALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M+A+ + + G PEVL+L+ ++  P  KD +VLIKV A  +N  +T  R G+Y   K   PY PG + +G I +VG N S +K GD+V  +    GGYAE        V  +P  +  K  AA      T +  +  ++ +  GES LVHG S G+G  A Q+ +  G+++  TAG+EE   +    GA    N++  +++ ++K+  G KG+D+I++ +      ++L  L+  GR+ +
Sbjct:    8 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSR-KPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIV 245          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_PIG (Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.491e-29
Identity = 82/239 (34.31%), Postives = 131/239 (54.81%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY-PGLECSGTILSVGKNVSRWKVGDQVCALLG-GGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M AI + + G PEV++LQ +V  P  KD++VLIKV A  +N  DT  R G++   K   PY PGL+ +G + +VG++VS +K GD+V  +    GGYAE        V  +P  +  K  AA      T    +  ++ +  GE  L+HG S G+G  A Q+ +  G++V  TAG+EE   +    GA    N++  +++ ++K+  G KG+DVI++ +       +L+ L+  GR+ I
Sbjct:    8 MSAIRVFKFGGPEVMKLQSDVAIPIPKDNQVLIKVHACGVNPVDTYIRSGTHNM-KPLLPYTPGLDVAGIVEAVGEHVSSFKKGDRVFTVSTLSGGYAEYALAADDTVYMLPEKLDFKQGAAIGIPYFTACLALLHSACVKAGEIVLIHGASGGVGIAACQIARAYGLKVLGTAGTEEGQNIVLQNGAHEVFNHREVNYIDKIKKSVGEKGIDVIIEMLANVNLSNDLNLLSHGGRVII 245          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: VAT1_DANRE (Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.254e-29
Identity = 86/241 (35.68%), Postives = 129/241 (53.53%), Query Frame = 3
Query:    3 ESEGTMKAIVITQPGSPEVLQLQEVED-PQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGK-CQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRL 719
            E   T +A+V+T  G  + ++LQ  +  P +K  EV+++V+   LN AD + R+G Y         PG+ECSG I +VG+ V+  KVGD+V  L   G + E V V +     +P G+S ++AAA P    T +  +F   HL P +S LVH  + G+G  A Q+ K    V VF TA S  K  V    G    I+Y+T D+V  V+ +   KG+D++LD +G S   +  + L   G+L
Sbjct:   66 EDTFTYRALVLTGYGGYDKVKLQVKKGKPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMECSGVIEAVGEEVTDRKVGDKVLVLNRSGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITAYMMLFDFGHLRPNQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTA-SASKHEVISQGGVTHPIDYRTRDYVEEVR-KISPKGLDIVLDPLGGSDTHKGYNLLKPMGKL 304          
BLAST of FC931140 vs. ExPASy Swiss-Prot
Match: QOR_LAMGU (Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.615e-28
Identity = 84/239 (35.15%), Postives = 129/239 (53.97%), Query Frame = 3
Query:   18 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY-PGLECSGTILSVGKNVSRWKVGDQVCALLG-GGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLDSLNIDGRLFI 725
            M+AI +++ G PEVL+LQ +V  P  ++ +VLIKV+A  +N  DT  R G+Y   K   PY PGL+ +G I +VG+ VS +K GD+V       GGYAE        V  +P  +  +  AA      T +  +  ++    GES LVHG S G+G  A Q+ +    +V  TAG+EE   V    GA    N++ +  + ++K+  G KG+DVI++ +       +L+ L+  GR+ I
Sbjct:    8 MRAIRVSEFGGPEVLKLQSDVAVPIPEEHQVLIKVQACGVNPVDTYIRSGTYSR-KPRLPYTPGLDVAGLIEAVGERVSAFKKGDRVFTTSTVSGGYAEYALAADHTVYKLPGELDFQKGAAIGVPYFTAYRALLHSACAKAGESVLVHGASGGVGLAACQIARACCFKVLGTAGTEEGQRVVLQNGAHEVFNHREDINIDKIKKSVGEKGIDVIIEMLANVNLSNDLNLLSQGGRVII 245          
The following BLAST results are available for this feature:
BLAST of FC931140 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 143
Match NameE-valueIdentityDescription
QORX_HUMAN9.401e-5345.30Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP5... [more]
QOR_BOVIN3.144e-3236.40Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2[more]
QOR_RAT1.195e-3136.40Quinone oxidoreductase OS=Rattus norvegicus GN=Cry... [more]
QOR_PONAB2.253e-3033.89Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=... [more]
QOR_MOUSE3.843e-3036.10Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=... [more]
QOR_CAVPO1.118e-2934.45Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ ... [more]
QOR_HUMAN1.907e-2933.05Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=... [more]
QOR_PIG2.491e-2934.31Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 ... [more]
VAT1_DANRE3.254e-2935.68Synaptic vesicle membrane protein VAT-1 homolog OS... [more]
QOR_LAMGU1.615e-2835.15Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34101H08EF PostHarvP1 Citrus clementina cDNA clone C34101H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931140 ID=FC931140|Name=FC931140|organism=Citrus clementina|type=EST|length=726bp
GGGAAAGTGAAGGCACAATGAAGGCAATAGTGATAACTCAACCCGGTAGC
CCAGAAGTGCTGCAGTTGCAAGAAGTAGAAGACCCTCAAATCAAAGACGA
CGAAGTGTTGATCAAAGTCGAAGCTACTGCCCTGAACCGGGCCGACACTC
TTCAACGAAAAGGCTCCTACCCTCCACCCAAAGGCGCCAGCCCTTACCCG
GGTCTCGAATGTTCCGGAACCATCCTGTCCGTTGGTAAAAACGTCTCTAG
ATGGAAAGTCGGCGACCAGGTGTGTGCTCTGCTTGGTGGAGGAGGGTATG
CTGAGAAAGTGGCTGTTCCAGCTGGACAAGTTCTTCCCGTTCCATCTGGT
GTCTCACTCAAAGATGCTGCTGCGTTTCCGGAGGTGGCTTGCACTGTTTG
GTCAACGGTTTTCATGACCAGTCACCTATCCCCAGGGGAGTCATTTCTGG
TTCATGGGGGCTCTAGTGGAATTGGTACATTTGCGATTCAGATGGGAAAA
TGCCAAGGAGTGAGAGTCTTTGTTACAGCAGGAAGTGAGGAAAAGCTGGC
TGTTTGCAAGGATCTTGGTGCGGATGTGTGCATCAATTACAAGACTGAGG
ATTTTGTTGCACGAGTGAAGGAAGAAACTGGTGGTAAAGGTGTTGATGTA
ATTCTAGATTGCATGGGAGCATCCTACTTTCAGCGTAACCTCGACAGCTT
GAACATTGATGGGAGGCTTTTCATAA
back to top