FC931142

Overview
NameFC931142
Unique NameFC931142
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931142 vs. ExPASy Swiss-Prot
Match: SALAT_PAPSO (Salutaridinol 7-O-acetyltransferase OS=Papaver somniferum GN=SALAT PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.046e-28
Identity = 71/173 (41.04%), Postives = 103/173 (59.54%), Query Frame = 2
Query:   53 VEIISRESIKPSSPTPLDLKTHKLCLMDQ-FLSNAYAPRVLYYPLNQDDLSSAIDIDHIVSERLQLLKQSLSETLVHFYPLAGKLTNNFSVDCNDEGVYFVEAAAKSPLNELLIQPDLNLINKLCPVDGSQQSGQVAGAHVAMVQVTSFACGGLVICACISHTFGDGTSFSSF 568
            VE+IS+E+IKP++PTP  LK   L L+DQ F    Y P +L+YP    + S+     H   + L LLK SLS+TLVHFYP+AG++ +N  VDC+D+G+ F +   +  + E + QPD+ L ++L P      S  V    + +VQV  F CGG  IC+ +SH   D  + S+F
Sbjct:    9 VEVISKETIKPTTPTPSQLKNFNLSLLDQCFPLYYYVPIILFYPATAAN-STGSSNHH---DDLDLLKSSLSKTLVHFYPMAGRMIDNILVDCHDQGINFYKVKIRGKMCEFMSQPDVPL-SQLLP--SEVVSASVPKEALVIVQVNMFDCGGTAICSSVSHKIADAATMSTF 174          

HSP 2 Score: 21.557 bits (44), Expect = 2.046e-28
Identity = 7/15 (46.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  625 ICPNYDASSLFLPNE 669
            + P++D++SLF P+E
Sbjct:  199 LIPSFDSASLFPPSE 213          
BLAST of FC931142 vs. ExPASy Swiss-Prot
Match: VINSY_RAUSE (Vinorine synthase OS=Rauvolfia serpentina GN=ACT PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 7.488e-23
Identity = 67/180 (37.22%), Postives = 99/180 (55.00%), Query Frame = 2
Query:   50 EVEIISRESIKPSSPTPLDLKTHKLCLMDQFLSNAYAPRVLYYPLNQDDLSSAIDIDHIVSERLQLLKQSLSETLVHFYPLAGKLTNNFSVDCNDEGVYFVEAAAKSPLNELLIQPDLNLINKLCPVDGSQQSGQVAGAHVAM-------VQVTSFACGGLVICACISHTFGDGTSFSSF 568
            ++E +S E I PSSPTP  LK +K+  +DQ L   + P +L+YP   + L S +D     ++  Q LKQSLS+ L HFYPLAG++  N SVDCND GV FVEA  ++ L++      +  + +L  +D    S    G  + +       V+++ F CGG  I   +SH   D  S ++F
Sbjct:    4 QMEKVSEELILPSSPTPQSLKCYKISHLDQLLLTCHIPFILFYP---NPLDSNLD----PAQTSQHLKQSLSKVLTHFYPLAGRINVNSSVDCNDSGVPFVEARVQAQLSQA-----IQNVVELEKLDQYLPSAAYPGGKIEVNEDVPLAVKISFFECGGTAIGVNLSHKIADVLSLATF 171          
BLAST of FC931142 vs. ExPASy Swiss-Prot
Match: BAHD1_ARATH (BAHD acyltransferase At5g47980 OS=Arabidopsis thaliana GN=BAHD1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.252e-18
Identity = 67/176 (38.07%), Postives = 91/176 (51.70%), Query Frame = 2
Query:   44 KMEVEIISRESIKPSSPTPLDLKTHKLCLMDQFLSNAYAPRVLYYPLNQDDLSSAIDIDHIVSERLQLLKQSLSETLVHFYPLAGKLTNNFSVDCNDEGVYFVEAAAKSPLNELLIQPDLNLINKLCPVDGSQQSGQVAGAHVAMVQVTSFACG-GLVICACISHTFGDGTSFSSF 568
            ++ +E+I RE IKPSSP P D    +L ++D  ++ A  P + +Y  N  DL+       IVS RL   + SLS+ L  FYPLAGK     S+ CNDEG  F EA     L+E L   D+N +  L P     +S  +    +  VQ T F  G GL +  C+SH   D  S S+F
Sbjct:    2 ELNLEVIQREVIKPSSPAPHDRL--QLSVIDFGIAEACVPMIFFY--NLADLAEKSP--DIVSTRL---RSSLSQALSRFYPLAGK-KEGVSISCNDEGAVFTEARTNLLLSEFLRNIDINSLKILIPTLAPGES--LDSRPLLSVQATFFGSGSGLAVGICVSHCICDAASVSTF 165          
BLAST of FC931142 vs. ExPASy Swiss-Prot
Match: DAT_CATRO (Deacetylvindoline O-acetyltransferase OS=Catharanthus roseus GN=DAT PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.253e-18
Identity = 62/183 (33.88%), Postives = 92/183 (50.27%), Query Frame = 2
Query:   38 KKKMEVEIISRESIKPSSPTPLDLKTHKLCLMDQFLSNAYAPRVLYYPLNQDDLSSAIDIDHIVSERLQLLKQSLSETLVHFYPLAGKLTNNFSVDCNDEGVYFVEAAAKSPLNELL------IQPDLNLINKLCPVDGSQQSGQVAGAHVAMVQVTSFACGGLVICACISHTFGDGTSFSSF 568
            K  +E E +S+  IKPSSPTP  L  + L   DQ +         +Y  N D +         +S   + L+ SLS+TLV +YP AGK+  N  + CND+G+ FVE   +  +N++L         DL L  ++    GS+ +        A+VQ++ F CGGL +   ISH   DG + +SF
Sbjct:    5 KISVETETLSKTLIKPSSPTPQSLSRYNLSYNDQNIYQTCVSVGFFYE-NPDGIE--------ISTIREQLQNSLSKTLVSYYPFAGKVVKNDYIHCNDDGIEFVEVRIRCRMNDILKYELRSYARDLVLPKRV--TVGSEDT-------TAIVQLSHFDCGGLAVAFGISHKVADGGTIASF 169          
The following BLAST results are available for this feature:
BLAST of FC931142 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SALAT_PAPSO2.046e-2841.04Salutaridinol 7-O-acetyltransferase OS=Papaver som... [more]
VINSY_RAUSE7.488e-2337.22Vinorine synthase OS=Rauvolfia serpentina GN=ACT P... [more]
BAHD1_ARATH4.252e-1838.07BAHD acyltransferase At5g47980 OS=Arabidopsis thal... [more]
DAT_CATRO7.253e-1833.88Deacetylvindoline O-acetyltransferase OS=Catharant... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34101H10EF PostHarvP1 Citrus clementina cDNA clone C34101H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931142 ID=FC931142|Name=FC931142|organism=Citrus clementina|type=EST|length=708bp
GAAACACTTTTTAGCCAATCACTTCAAGAAAGCTCTGAAAAAGAAAATGG
AGGTAGAAATAATTTCTAGAGAGAGCATCAAACCCTCTTCCCCGACACCA
CTTGACCTAAAAACCCACAAGCTCTGTCTCATGGATCAATTTCTGAGTAA
TGCCTACGCTCCAAGGGTTCTATACTATCCCCTCAACCAAGACGACCTTT
CATCCGCCATTGATATTGATCATATTGTCTCGGAAAGATTGCAACTACTG
AAGCAGTCTCTATCAGAAACTTTAGTTCACTTTTACCCACTTGCTGGAAA
ATTGACAAACAACTTTTCCGTTGACTGCAACGACGAGGGAGTTTATTTTG
TAGAAGCCGCAGCCAAAAGTCCACTCAATGAACTTCTCATACAACCCGAT
CTGAACTTGATAAATAAATTATGTCCGGTAGATGGCAGCCAACAGAGTGG
ACAAGTAGCGGGAGCTCACGTGGCTATGGTACAGGTAACATCATTTGCAT
GTGGTGGTCTTGTTATTTGTGCTTGTATTTCACATACGTTTGGTGATGGC
ACAAGTTTTAGCTCGTTTACGAAGGCTTGGGCTGCCACAGCTCGTAAGAA
AACTTCGGAAGAAGAACCATATTTATATGTCCTAATTATGATGCTTCATC
TTTGTTTCTTCCTAATGAAGATGATTTATTTCATCAATTAAGAGCCGTNC
TCAATGCC
back to top