FC931144

Overview
NameFC931144
Unique NameFC931144
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length751
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931144_ssr40 microsatellite FC931144_ssr40:40..51. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15281 contig Ccv1_Contig15281:1..751. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_MALDO (Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.042e-49
Identity = 103/215 (47.91%), Postives = 145/215 (67.44%), Query Frame = 2
Query:   62 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKRSTTY 697
            VCVTGASG+I SWLV  LL  GYTV+A+VRDP + KK +HLL L  A   L L+KA+L +EGSFD  + GC GV H A+P   ++KDP+ E++ P + G L++L +C K  +++++V TSS A  +N  + + P  V DE+ +SD E C+  ++  W Y +SKTLAE AAWK+AKE +ID +TI P +VIGP L P++  S    LS I R+ ++
Sbjct:    8 VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSS-AGTVNVEEHQKP--VYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVIGPFLMPSMPPSLITGLSPILRNESH 219          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_PYRCO (Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.321e-49
Identity = 102/215 (47.44%), Postives = 145/215 (67.44%), Query Frame = 2
Query:   62 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKRSTTY 697
            VCVTGASG+I SWLV  LL  GYTV+A+VRDP + KK +HLL L  A   L L+KA+L +EGSFD  + GC GV H A+P   +++DP+ E++ P + G L++L +C K  +++++V TSS A  +N  + + P  V DE+ +SD E C+  ++  W Y +SKTLAE AAWK+AKE +ID +TI P +VIGP L P++  S    LS I R+ ++
Sbjct:    8 VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIQGCSGVFHVATPMDFESRDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSS-AGTVNVEEHQKP--VYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVIGPFLMPSMPPSLITGLSPILRNESH 219          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_VITVI (Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.705e-47
Identity = 99/211 (46.92%), Postives = 140/211 (66.35%), Query Frame = 2
Query:   56 KVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLI 679
            + VCVTGASG+I SWLV  LL R  TV+A+VRDP + KK +HLL L  A   L L+KA+L +EGSFD  + GC GV H A+P   ++KDP+ E++ P ++G L ++ SCA   +++R+V TSS A  +N  + + P  V DE+ +SD E C+  ++  W Y +SKTLAE AAWK+AKE +ID +TI P +V+GP +  ++  S    LS I
Sbjct:    6 ETVCVTGASGFIGSWLVMRLLERRLTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSS-AGTVNIQEHQLP--VYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPI 213          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_DIACA (Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.320e-47
Identity = 100/218 (45.87%), Postives = 144/218 (66.06%), Query Frame = 2
Query:   53 GKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKRSTTY 697
            G+ VCVTGASG+I SWL+  LL RGYTV+A+VRDP++ KK +HLL L  A   L L+KA+L EEGSFD+ VDGC GV H A+P   ++KDP+ E++ P + G L++L SC K   ++RVV TSS    +N    + P  V DET +S  +  +  ++  W Y +SK LAE AAWK+A E +++ ++I P +V+GP + P++  S    LS I R+ ++
Sbjct:   22 GETVCVTGASGFIGSWLIMRLLERGYTVRATVRDPDNTKKVQHLLDLPNAKTNLTLWKADLHEEGSFDAAVDGCTGVFHIATPMDFESKDPENEMIKPTINGMLDILKSCVK-AKLRRVVFTSS-GGTVNVEATQKP--VYDETCWSALDFIRSVKMTGWMYFVSKILAEQAAWKYAAENNLEFISIIPPLVVGPFIMPSMPPSLITALSPITRTESH 235          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_CALCH (Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.078e-46
Identity = 100/215 (46.51%), Postives = 143/215 (66.51%), Query Frame = 2
Query:   62 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPE--VCKQSELW-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKRSTTY 697
            VCVTGA+G+I SWLV  LL RGY V+A+VR+P D KK +HLL L  A   L L+KA+L +EGSFD  ++GC GV H A+P   ++KDP+ E++ P ++G L+++ SCAK  ++K++V TSS A  +N  + + P  V DE+ +SD +    K+   W Y +SKTLAE AA + AKE +ID V+I P +V+GP + PT   S    LSLI  + ++
Sbjct:    9 VCVTGAAGFIGSWLVMRLLERGYIVRATVRNPGDMKKVKHLLELPKAETNLTLWKADLTQEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGILSIIRSCAKAKTVKKLVYTSS-AGTVNVQETQLP--VYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAMEAAKENNIDFVSIIPPLVVGPFINPTFPPSLITALSLINGAESH 220          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_ARATH (Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=2 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 3.468e-45
Identity = 99/217 (45.62%), Postives = 140/217 (64.52%), Query Frame = 2
Query:   56 KVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPE--VCKQSELW-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKRSTTY 697
            + VCVTGASG+I SWLV  LL RGY V+A+VRDP + KK +HLL L  A   L L+KA+L EEGS+D  ++GCDGV H A+P   ++KDP+ E++ P V G L ++ +C K  +++R V TSS A  +N  + +    V DE  +SD E  + K+   W Y +SKTLAE AAW FA+EK +D ++I P +V+GP +  ++  S    LS I R+  +
Sbjct:    6 ETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWKADLSEEGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTSS-AGTVNVEEHQKN--VYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFISIIPTLVVGPFITTSMPPSLITALSPITRNEAH 219          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_GERHY (Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 8.542e-44
Identity = 95/209 (45.45%), Postives = 130/209 (62.20%), Query Frame = 2
Query:   62 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPE--VCKQSELW-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLI 679
            VCVTGA+G+I SWLV  LL RGY V A+VRDP D KK +HLL L  A   L+L+KA+L +EGSFD  + GC GV H A+P   ++KDP+ E++ P ++G L+++ SC K  ++K++V TSS   V    K      V DE+ +SD +    K+   W Y +SKTLAE AAW   K  +I  ++I P +V+GP +  T   S    LSLI
Sbjct:    9 VCVTGAAGFIGSWLVMRLLERGYVVHATVRDPGDLKKVKHLLELPKAQTNLKLWKADLTQEGSFDEAIQGCHGVFHLATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTVNGQEKQLH---VYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWDATKGNNISFISIIPTLVVGPFITSTFPPSLVTALSLI 214          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_PETHY (Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 1.903e-43
Identity = 97/209 (46.41%), Postives = 134/209 (64.11%), Query Frame = 2
Query:   62 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVC---KQSELWYPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLI 679
            VCVTGA+G+I SWLV  LL RGY V A+VRDP + KK +HLL L  A   L L+KA+L  EGSFD  + GC GV H A+P   ++KDP+ E++ P V+G L+++ SCAK  ++KR+V TSS A  L+  + +   +  D+T +SD +     K +   Y  SK LAE AA + AK+K+ID ++I P +V+GP + PT   S    LSLI
Sbjct:   18 VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSS-AGTLDVQEQQ--KLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKKNIDFISIIPPLVVGPFITPTFPPSLITALSLI 223          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_HORVU (Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.104e-42
Identity = 90/209 (43.06%), Postives = 137/209 (65.55%), Query Frame = 2
Query:   62 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLI 679
            V VTGASG++ SWLV  LL  GYTV+A+VRDP + +KT+ LL L GA ERL ++KA+L E+GSF+  + GC GV H A+P   D++DP+ E++ P V+G L+++ +C +  ++KR+V TSS  +V    +PR      D+  +SD + C++ ++  W Y +SK LAE AA ++A E  +D ++I P +V+GP L   +  S    L+LI
Sbjct:    8 VVVTGASGFVGSWLVMKLLQAGYTVRATVRDPANVEKTKPLLELPGAKERLSIWKADLSEDGSFNEAIAGCTGVFHVATPMDFDSQDPENEVIKPTVEGMLSIMRACKEAGTVKRIVFTSSAGSVNIEERPRP---AYDQDNWSDIDYCRRVKMTGWMYFVSKALAEKAAMEYASENGLDFISIIPTLVVGPFLSAGMPPSLVTALALI 213          
BLAST of FC931144 vs. ExPASy Swiss-Prot
Match: DFRA_ANTMA (Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.104e-42
Identity = 93/221 (42.08%), Postives = 134/221 (60.63%), Query Frame = 2
Query:   26 TMSSVAAAAGKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLI 679
            T S  A  +   VCVTGA+G+I SWLV  LL RGYTV+A+VRDP + KK +HL+ L  A   L L+KA++  EGSFD  + GC+GV H A+    D+ DP+ E++ P + G LN++ SC +  ++K+ + T+S    +N  + + P  V DET  SD +     ++  W Y +SK LAE A  + AKE +ID ++I P +V+GP + PT   S    LS I
Sbjct:    8 TSSETAPPSSTTVCVTGAAGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLIELPKADTNLTLWKADMTVEGSFDEAIQGCEGVFHLATSMEFDSVDPENEVIKPTIDGMLNIIKSCVQAKTVKKFIFTTS-GGTVNVEEHQKP--VYDETDSSDMDFINSKKMTGWMYFVSKILAEKAGMEAAKENNIDFISIIPPLVVGPFIMPTFPPSLITALSPI 225          
The following BLAST results are available for this feature:
BLAST of FC931144 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
DFRA_MALDO1.042e-4947.91Bifunctional dihydroflavonol 4-reductase/flavanone... [more]
DFRA_PYRCO2.321e-4947.44Bifunctional dihydroflavonol 4-reductase/flavanone... [more]
DFRA_VITVI3.705e-4746.92Dihydroflavonol-4-reductase OS=Vitis vinifera GN=D... [more]
DFRA_DIACA6.320e-4745.87Dihydroflavonol-4-reductase OS=Dianthus caryophyll... [more]
DFRA_CALCH1.078e-4646.51Dihydroflavonol-4-reductase OS=Callistephus chinen... [more]
DFRA_ARATH3.468e-4545.62Dihydroflavonol-4-reductase OS=Arabidopsis thalian... [more]
DFRA_GERHY8.542e-4445.45Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=... [more]
DFRA_PETHY1.903e-4346.41Dihydroflavonol-4-reductase OS=Petunia hybrida GN=... [more]
DFRA_HORVU2.104e-4243.06Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=... [more]
DFRA_ANTMA2.104e-4242.08Dihydroflavonol-4-reductase OS=Antirrhinum majus G... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34101H12EF PostHarvP1 Citrus clementina cDNA clone C34101H12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931144 ID=FC931144|Name=FC931144|organism=Citrus clementina|type=EST|length=751bp
GAACGATTGCGAGAATCAGTAGTTGACAATGAGCAGTGTAGCAGCAGCAG
CGGGGAAGGTCGTATGCGTGACCGGAGCATCGGGTTACATAGCTTCATGG
CTTGTCAAGCTTCTTCTTTCTCGTGGCTACACTGTCAAGGCCTCTGTTCG
TGATCCCAATGATCCAAAAAAGACAAGACACTTACTTGCACTTGATGGAG
CTTCGGAAAGACTTCAGTTGTTTAAGGCAAATCTTTTGGAAGAAGGATCC
TTTGATTCAATTGTTGATGGGTGCGATGGTGTTTGCCATACTGCATCTCC
CTTTTACCATGATGCCAAGGATCCGCAGGTGGAGTTACTTGATCCTGCTG
TGAAAGGAACTCTTAATGTTCTTAACTCATGTGCGAAGTTCCCTTCTATC
AAACGAGTGGTTTTAACATCTTCAATGGCTGCAGTTTTAAACACTGGAAA
ACCTCGAACCCCTGATGTGGTAGTTGATGAGACTTGGTTCTCGGATCCGG
AGGTTTGCAAGCAATCAGAGCTCTGGTATCCACTTTCAAAGACATTGGCT
GAGGATGCAGCTTGGAAATTTGCAAAGGAGAAGAGTATTGACTTGGTTAC
CATTAACCCGGCAATGGTTATTGGTCCTCTCTTACAGCCAACACTTAACA
CAAGTGCTGCTGCAGTTCTAAGCTTAATTAAAAGGAGCACAACTTACCCA
ATGTAACTTTTGGATGGGTTAACGTTAAAGATGTTGCCAATGCACATATT
C
back to top