FC931156

Overview
NameFC931156
Unique NameFC931156
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length694
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:132..825. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 3.157e-95
Identity = 169/231 (73.16%), Postives = 199/231 (86.15%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINKDLKADPND-EYLKLLRAAIKCLTYPEKHFAKVLRLAIN 692
            GWGTNE LIIS+LAHRNAAQR LIR +Y  TY EDLLKALDKELSSDFER+V+LWTL P ERDAYLA E+TK  T +NWVL+EIACTR + +L+  KQAY ARYKKS+EEDVA HTSGD RKLL+PLVSTFRY+G DVNMMLAR+EAKI+ +K+S+K Y+ ++ IRILTTRSKAQ+ ATLNHYN+ +GNAINK+LK + +D +Y+KLLRA I CLTYPEKHF KVLRL+IN
Sbjct:   26 GWGTNEKLIISILAHRNAAQRSLIRSVYAATYNEDLLKALDKELSSDFERAVMLWTLDPPERDAYLAKESTKMFTKNNWVLVEIACTRPALELIKVKQAYQARYKKSIEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKILHEKVSEKSYSDDDFIRILTTRSKAQLGATLNHYNNEYGNAINKNLKEESDDNDYMKLLRAVITCLTYPEKHFEKVLRLSIN 256          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 1.793e-90
Identity = 162/230 (70.43%), Postives = 191/230 (83.04%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINKDLKADPNDEYLKLLRAAIKCLTYPEKHFAKVLRLAIN 692
            GWGTNE +IIS+LAHRNA QR  IR +Y   Y +DLLK LD+ELS DFER+V+LWT  PAERDAYLA E+TK  T +NWVL+EIACTRS+ +L  AKQAY ARYK SLEEDVAYHTSGD RKLLVPLVSTFRYDG +VNM LAR+EAKI+ +KI +K YA ++LIRILTTRSKAQI+ATLNHY + FG +++K LK D  +EY++LL+A IKCLTYPEK+F KVLR AIN
Sbjct:   26 GWGTNERMIISILAHRNATQRSFIRAVYAANYNKDLLKELDRELSGDFERAVMLWTFEPAERDAYLAKESTKMFTKNNWVLVEIACTRSALELFNAKQAYQARYKTSLEEDVAYHTSGDIRKLLVPLVSTFRYDGDEVNMTLARSEAKILHEKIKEKAYADDDLIRILTTRSKAQISATLNHYKNNFGTSMSKYLKEDSENEYIQLLKAVIKCLTYPEKYFEKVLRQAIN 255          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 4.882e-88
Identity = 161/232 (69.40%), Postives = 186/232 (80.17%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGG--DVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINKDLKADPNDEYLKLLRAAIKCLTYPEKHFAKVLRLAIN 692
            GWGTNE +IIS+LAHRNA QR  IR +Y   Y +DLLK LD ELS DFER V+LWTL P ERDAYLANE+TK  T + WVL+EIACTR S +    KQAYH RYK SLEEDVAYHTSG+ RKLLVPLVSTFRYDG   +VN+ LAR+EAK +  KI++K Y  E+LIRILTTRSKAQINATLNH+ D FG++INK LK D ND+Y++LL+ AIKCLTYPEK+F KVLR AIN
Sbjct:   26 GWGTNEGMIISILAHRNATQRSFIRAVYAANYNKDLLKELDGELSGDFERVVMLWTLDPTERDAYLANESTKLFTKNIWVLVEIACTRPSLEFFKTKQAYHVRYKTSLEEDVAYHTSGNIRKLLVPLVSTFRYDGNADEVNVKLARSEAKTLHKKITEKAYTDEDLIRILTTRSKAQINATLNHFKDKFGSSINKFLKEDSNDDYVQLLKTAIKCLTYPEKYFEKVLRRAIN 257          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 7.794e-86
Identity = 159/231 (68.83%), Postives = 191/231 (82.68%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINKDL-KADPNDEYLKLLRAAIKCLTYPEKHFAKVLRLAIN 692
            GWGTNE LIIS+LAHR+A QRK+IR+ Y+ETYGEDLLK LDKELS+DFER++LLWTL P ERDA LANEATKR TSSN VLME+ACTR+S  LL A+QAYHARYKKSLEEDVA+HT+GDFRKLLV LV+++RY+G +VNM LA+ EAK++ +KI DK Y  E++IRIL+TRSKAQINAT N Y D  G  I K L + D +D++L LLR+ I+CLT PE +F  VLR AIN
Sbjct:   26 GWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLALLRSTIQCLTRPELYFVDVLRSAIN 256          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 8.958e-66
Identity = 127/229 (55.46%), Postives = 163/229 (71.18%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINKDLKADPNDEYLKLLRAAIKCLTYPEKHFAKVLRLAI 689
            GWGTNE  IIS+L HRNA QRK IR  Y + Y EDLLK L+ ELS DFE++V  WTL PA+RDA LAN A K+ T    V++EI+C  S  +LLA ++AY  RYK S+EED+A HT+GD RKLLV LV+ +RYDG ++N  LA +EA I+ D I DK + HEE+IRIL+TRSK Q+ AT N Y D  G +I+K+L  +  +++ K L  AI+CL  P+K+F KVLR AI
Sbjct:   25 GWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDLLKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKSTDVYNVIIEISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILHDAIKDKAFNHEEIIRILSTRSKTQLMATFNKYRDDQGISISKNLLEEGANDFQKALHTAIRCLNDPKKYFEKVLRNAI 253          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 4.326e-44
Identity = 102/235 (43.40%), Postives = 140/235 (59.57%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN-----EATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINKDLKADPNDEYLK-LLRAAIKCLTYPEKHFAKVLRLAI 689
            GWGT+E  II VL  R+ +QR+ IRE + E YG+DL+  L  ELS DF ++V+ WT  PAERDA L N     E  K+   +  V++EI+CT S   L+A ++AY + +  SLEE +A        KLLV L STFRYD    +  +A  EA ++R+ I  K   H+ ++ IL TRS  Q+  T   Y   +G  I+KD+   P D  L+ LL+ AI C+  PEKHFAKV+R +I
Sbjct:   26 GWGTDEKAIIRVLGQRDQSQRRKIRESFREIYGKDLIDVLSSELSGDFMKAVVSWTYDPAERDARLVNKILNKEKKKKSLENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHIASSLPFPLAKLLVTLASTFRYDKDRTDAEVATIEAAMLREAIEKKQLDHDHVLYILGTRSIYQLRETFVAYKKNYGVTIDKDVDGCPGDADLRSLLKVAIFCIDTPEKHFAKVVRDSI 260          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANXD4_ARATH (Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.014e-33
Identity = 84/243 (34.57%), Postives = 137/243 (56.38%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDK-------ELSSDFER---SVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKIS---DKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINKDLKADPNDEYLKLLRAAIKCLTYPEKHFAKVLRLAIN 692
            G G +E  +IS L       RKL R+     + ED  +A +K        L  +F R   +V++W + P ERDA L  +A K+   +  +++E++CTRS+ DLL A++AYH+ + +S+EED+A H  G  RKLLV LVS +RY+G  V    A+++AKI+ + ++   ++    +E++RILTTRSK  +     H+N+  G+ +   +          LL  A+ CL  P  +F+K+L  ++N
Sbjct:   19 GMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNTAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEAVEKDEVVRILTTRSKLHLQHLYKHFNEIKGSDLLGGVSKS------SLLNEALICLLKPALYFSKILDASLN 255          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANX13_HUMAN (Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3)

HSP 1 Score: 131.724 bits (330), Expect = 3.556e-30
Identity = 82/232 (35.34%), Postives = 128/232 (55.17%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI--RILTTRSKAQINATLNHYNDAFG----NAINKDLKADPNDEYLKLLRAAIKCLTYPEKHFAKVLR 680
            G GTNEA II +L+ R + +R+ I++ Y  TYG++L + L  ELS +FE++ L     P+E  A    +A K L +   VL+E+ CTR++++++A K+AY   + +SLE DV   TSG+ +K+LV L+   R +G DV+  LA  +AK + D   +  +  +EL    +L  RS  Q+ AT   Y    G     AI ++   D    YL L+R A  C  Y  +   K ++
Sbjct:   29 GMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD-AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMK 259          

HSP 2 Score: 72.4034 bits (176), Expect = 2.560e-12
Identity = 43/130 (33.08%), Postives = 67/130 (51.54%), Query Frame = 3
Query:    6 WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNW---VLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 386
            WGT+E     VLA R+  Q +   + Y    G+D+ +A+++E S D +++ L       + + Y A    K +  +      L+ I  TR+  DL   K  +  +Y+KSL + V   TSGDFRKLLV L+
Sbjct:  186 WGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANXD5_ARATH (Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 1.035e-29
Identity = 69/227 (30.40%), Postives = 122/227 (53.74%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHYNDAFGNAINKDLKADPNDEYLKLLRAAIKCLTYPEKHFAKVLR 680
            G G + ++II++LAHRNA QR LI + Y   + +DL K L  EL    +++VLLW     ERDA +   + +   + +  + EI CTRS   L   KQ Y   +   LEED+    SG+ +++L+  ++T RY+G +++      +A+ ++  ++ K  + ++ LI+I T RS+  + A  + Y   +G  + K ++ +    +  +L   ++C      +FAK LR
Sbjct:   26 GRGCDTSVIINILAHRNATQRALIEQEYETKFSDDLRKRLHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGSQLRQIKQVYSNTFGVKLEEDIESEASGNHKRVLLAYLNTTRYEGPEIDNASVENDARTLKSAVARKHKSDDQTLIQIFTDRSRTHLVAVRSTYRSMYGKELGKAIRDETRGNFEHVLLTILQCAENSCFYFAKALR 252          
BLAST of FC931156 vs. ExPASy Swiss-Prot
Match: ANX13_CANFA (Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 1.035e-29
Identity = 77/224 (34.38%), Postives = 125/224 (55.80%), Query Frame = 3
Query:    3 GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI--RILTTRSKAQINATLNHYNDAFGNAINKDLKADPNDEYLKLLRAAIKCLTYPEKHFA 668
            G GT+EA II +L+ R + +R+ I++ Y  TYG+DL +    +LS +FE++ L     P+E DA    +A K L +   VL+EI CTR++++++A K+AY   + +SLE DV   TSG+ + +LV L+   R +G DV+  LA  +AK + D   D  +  +EL    +L  RS  Q+ AT   Y       I + ++A+ + +  K     ++C    E +FA
Sbjct:   29 GMGTDEAAIIEILSSRTSDERQQIKQKYKATYGKDLEEVFKSDLSGNFEKTALALLDRPSEYDARQLQKAMKGLGTDEAVLIEILCTRTNKEIMAIKEAYQRLFDRSLESDVKADTSGNLKAILVSLLQANRDEGDDVDKDLAGQDAKDLYD-AGDGRWGTDELAFNEVLAKRSHKQLRATFQAYQILIDKDIEEAIEAETSGDLQKAYLTLVRCARDQEGYFA 251          

HSP 2 Score: 69.707 bits (169), Expect = 1.659e-11
Identity = 41/130 (31.54%), Postives = 67/130 (51.54%), Query Frame = 3
Query:    6 WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNW---VLMEIACTRSSRDLLAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 386
            WGT+E     VLA R+  Q +   + Y     +D+ +A++ E S D +++ L       +++ Y A+   K +  +      L+ I  TR+  DL   K  +  +Y+KSL + V   TSGDF+KLLV L+
Sbjct:  186 WGTDELAFNEVLAKRSHKQLRATFQAYQILIDKDIEEAIEAETSGDLQKAYLTLVRCARDQEGYFADRLYKSMKGTGTDEETLIHIIVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFQKLLVALL 315          
The following BLAST results are available for this feature:
BLAST of FC931156 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXD2_ARATH3.157e-9573.16Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANXD7_ARATH1.793e-9070.43Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANXD6_ARATH4.882e-8869.40Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANXD1_ARATH7.794e-8668.83Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANX4_FRAAN8.958e-6655.46Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD3_ARATH4.326e-4443.40Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANXD4_ARATH2.014e-3334.57Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV... [more]
ANX13_HUMAN3.556e-3035.34Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3[more]
ANXD5_ARATH1.035e-2930.40Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV... [more]
ANX13_CANFA1.035e-2934.38Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102A12EF PostHarvP1 Citrus clementina cDNA clone C34102A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931156 ID=FC931156|Name=FC931156|organism=Citrus clementina|type=EST|length=694bp
AAGGATGGGGCACGAATGAGGCCCTCATTATATCTGTCTTGGCTCACAGA
AATGCAGCTCAGCGCAAGTTGATTCGAGAAATCTACAACGAAACTTATGG
GGAAGACCTTCTTAAAGCACTGGACAAAGAACTTTCAAGTGACTTTGAGA
GATCTGTACTCCTATGGACATTGACTCCTGCTGAGCGTGATGCTTATTTG
GCAAATGAAGCGACAAAGAGATTGACTTCAAGCAACTGGGTTCTCATGGA
AATTGCCTGTACTAGATCTTCAAGAGACCTACTTGCTGCAAAGCAGGCCT
ACCATGCTCGTTACAAGAAATCCCTAGAGGAAGATGTTGCATATCACACA
TCTGGGGACTTCCGCAAGCTTTTGGTTCCTCTTGTGAGCACATTTCGATA
TGATGGAGGAGATGTGAACATGATGTTGGCAAGAACTGAGGCTAAGATTA
TCCGTGACAAGATTTCAGACAAGGATTATGCTCATGAGGAGCTTATCAGG
ATTCTGACTACAAGGAGCAAGGCACAGATAAATGCGACCCTCAATCACTA
CAATGATGCTTTTGGAAATGCCATCAACAAGGATTTGAAGGCTGATCCCA
ATGATGAATACCTCAAACTGCTGAGAGCGGCAATTAAGTGCTTGACATAC
CCTGAGAAACACTTTGCGAAGGTTCTCCGATTGGCCATCAACGG
back to top