FC931160

Overview
NameFC931160
Unique NameFC931160
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15284 contig Ccv1_Contig15284:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADS3_ARATH (Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic OS=Arabidopsis thaliana GN=ADS3 PE=2 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 2.911e-59
Identity = 100/140 (71.43%), Postives = 120/140 (85.71%), Query Frame = 3
Query:  291 YGRILLSDVLVKRRRSL-FSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            Y RI+LSDVLVK++  + +    W ++D     VVL+MHLL+L APF F W ++ VAFGLY+VTGLLGITLSFHRNLSH++FKLPKWLEYLFAYCG Q+LQGNPIDWVSTHRYHHQFCDS+RDPHSP++GFWFSHM+W+F
Sbjct:   75 YRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGNPIDWVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMF 214          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADS1_ARATH (Delta-9 acyl-lipid desaturase 1 OS=Arabidopsis thaliana GN=ADS1 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.329e-45
Identity = 82/128 (64.06%), Postives = 101/128 (78.91%), Query Frame = 3
Query:  324 KRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            +++R+++    W  LDI  A   L +H L L APF FTW +LRVA  +Y V GL GIT+S+HRNL+HRSFK+PKWLEY FAYCG+ ++QG+PIDWVSTHRYHHQF DS+RDPHSP EGFWFSH+ WLF
Sbjct:   24 RKKRAMWER-KWKRLDIVKAFASLFVHFLCLLAPFNFTWPALRVALIVYTVGGL-GITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFSHLLWLF 149          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADS2_ARATH (Delta-9 acyl-lipid desaturase 2 OS=Arabidopsis thaliana GN=ADS2 PE=2 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 2.645e-44
Identity = 80/128 (62.50%), Postives = 96/128 (75.00%), Query Frame = 3
Query:  324 KRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            K+RR +F    W  LD         +H LAL APF FTWS+L V F  Y + GL GIT+S+HRNL+HRSFK+PKWLEYL AYC + ++QG+PIDWVSTHRYHHQF DSERDPHSP EGFWFSH+ W++
Sbjct:   25 KKRRWVFWDRRWRRLDYVKFSASFTVHSLALLAPFYFTWSALWVTFLFYTIGGL-GITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSHLLWIY 151          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADS32_ARATH (Probable lipid desaturase ADS3.2, chloroplastic OS=Arabidopsis thaliana GN=ADS3.2 PE=2 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 3.233e-42
Identity = 78/137 (56.93%), Postives = 101/137 (73.72%), Query Frame = 3
Query:  297 RILLSDVLVKRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            R LLS+V+V R +  F   +W S D+S   + +  HLL+L APF F+W +  V   L  + G+  ITLS+HRNLSHRSF LPKWLEYLFAY GV + QG+PI+WVS HRYHH+ C+++RDPHSP +GFWFSHM+W+F
Sbjct:   71 RRLLSEVVVVRTKRSFWERSWTSWDVSKLVIFVGTHLLSLLAPFYFSWEAFWVFPWLVFINGIC-ITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQGDPIEWVSNHRYHHKHCETQRDPHSPTQGFWFSHMAWIF 206          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADSL1_ARATH (Delta-9 desaturase-like 1 protein OS=Arabidopsis thaliana GN=At1g06090 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.096e-41
Identity = 77/129 (59.69%), Postives = 95/129 (73.64%), Query Frame = 3
Query:  321 VKRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            V+  +  F    W  +DI+ A  V A+HLL L APF + W +LR    L +VT L  IT S+HRNL+H+SFKLPKWLEY FAY  + +LQG+PIDWVSTHR+HHQF DS+RDPHSPIEGFWFSH+ W+F
Sbjct:   16 VRGEKRAFFFRKWTRIDIARASAVGAVHLLCLLAPFNYKWEALRFGVILAIVTSL-SITFSYHRNLTHKSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIF 143          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADSL3_ARATH (Delta-9 desaturase-like 3 protein OS=Arabidopsis thaliana GN=At1g06120 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 7.963e-41
Identity = 75/129 (58.14%), Postives = 94/129 (72.87%), Query Frame = 3
Query:  321 VKRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            V++ +  F    W  +D+     V A+HLL L APF +TW + R A  + + T L  IT S+HRNL+HRSFKLPKWLEY FAY  + +LQG+PIDWVSTHR+HHQF DS+RDPHSPIEGFWFSH+ W+F
Sbjct:   16 VRKEKRAFLFRKWTRVDVMRVSAVGAVHLLCLLAPFNYTWEAFRFAAMVGISTNL-SITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIF 143          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADSL2_ARATH (Delta-9 desaturase-like 2 protein OS=Arabidopsis thaliana GN=At1g06100 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.562e-39
Identity = 71/129 (55.04%), Postives = 91/129 (70.54%), Query Frame = 3
Query:  321 VKRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            V++ +  +    W   D+  A  V  +HLL L APF + W + R    L ++T L  IT S+HRNL+HRSFKLPKWLEY FAY  + +LQG+P+DWVS HR+HHQF DS+RDPHSPIEGFWFSH+ W+F
Sbjct:   16 VRKEKRAYVLRKWTQFDVGRASTVGTVHLLCLLAPFNYKWEAFRFGIILAILTNLC-ITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIF 143          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADSL5_ARATH (Delta-9 desaturase-like 5 protein OS=Arabidopsis thaliana GN=At1g06360 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.453e-39
Identity = 73/128 (57.03%), Postives = 91/128 (71.09%), Query Frame = 3
Query:  321 VKRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWL 704
            V + +  +    W+  DI  A  V+ +H L L APF + W +LR  F LY +T L  IT S+HRNL+HRSFKLPKWLEY  AY  V +LQG+P+DWVS HR+HHQF DS+RDPHSPIEGFWFSH+ W+
Sbjct:   16 VSKEKRPYIHREWSWADIIRALTVINVHFLCLLAPFNYKWEALRFGFVLYALTSL-SITFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVWWI 142          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ADSL4_ARATH (Delta-9 desaturase-like 4 protein OS=Arabidopsis thaliana GN=At1g06350 PE=2 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 4.090e-37
Identity = 73/131 (55.73%), Postives = 92/131 (70.23%), Query Frame = 3
Query:  315 VLVKRRRSLFSGGNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLF 707
            V   ++R+ F    W  +D+  A VV+ +H L L APF F W +LR    L+ +T  L IT SFHRNLSHRSFK+PKWLEY +AY  V +LQG+P+DWVS HR+HHQF DS+RDPHSP EG  FSH+ W+F
Sbjct:   16 VSTMQKRAYFQR-QWPLVDVVRASVVVIVHFLCLLAPFNFKWEALRFGLVLFALT-TLSITFSFHRNLSHRSFKIPKWLEYPWAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHILWIF 144          
BLAST of FC931160 vs. ExPASy Swiss-Prot
Match: ACO1_SCHPO (Probable acyl-CoA desaturase OS=Schizosaccharomyces pombe GN=SPCC1281.06c PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.802e-15
Identity = 37/118 (31.36%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  357 WNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGL--YVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWL 704
            W  L+     ++  + ++A++  F     +  + F +  Y  +GL GIT  +HR  SHR++K  K LEY  A  G  + +G+   W   HR HH++ D+++DP++  +GFW++H+ W+
Sbjct:   59 WRHLNWLHCMLIFGLPMIAIYGVFTTPLQTKTLIFAIIYYAYSGL-GITAGYHRLWSHRAYKAKKPLEYFLAAGGAAAFEGSIRWWSRDHRAHHRYTDTDKDPYNVKKGFWYAHVGWM 175          
The following BLAST results are available for this feature:
BLAST of FC931160 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
ADS3_ARATH2.911e-5971.43Palmitoyl-monogalactosyldiacylglycerol delta-7 des... [more]
ADS1_ARATH5.329e-4564.06Delta-9 acyl-lipid desaturase 1 OS=Arabidopsis tha... [more]
ADS2_ARATH2.645e-4462.50Delta-9 acyl-lipid desaturase 2 OS=Arabidopsis tha... [more]
ADS32_ARATH3.233e-4256.93Probable lipid desaturase ADS3.2, chloroplastic OS... [more]
ADSL1_ARATH2.096e-4159.69Delta-9 desaturase-like 1 protein OS=Arabidopsis t... [more]
ADSL3_ARATH7.963e-4158.14Delta-9 desaturase-like 3 protein OS=Arabidopsis t... [more]
ADSL2_ARATH2.562e-3955.04Delta-9 desaturase-like 2 protein OS=Arabidopsis t... [more]
ADSL5_ARATH7.453e-3957.03Delta-9 desaturase-like 5 protein OS=Arabidopsis t... [more]
ADSL4_ARATH4.090e-3755.73Delta-9 desaturase-like 4 protein OS=Arabidopsis t... [more]
ACO1_SCHPO9.802e-1531.36Probable acyl-CoA desaturase OS=Schizosaccharomyce... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102B04EF PostHarvP1 Citrus clementina cDNA clone C34102B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931160 ID=FC931160|Name=FC931160|organism=Citrus clementina|type=EST|length=707bp
GACGCAGAGAAAACGGAAAGCCTTTCTCCATGGCTTTCATCACAACATCA
CCAACCAAACCAAAATCTTTCACTTTTTCACCTCTGTGTCAAGCAAGAAA
AACTCAAACCGATAAAGTTCTGGCCTTCGGCAATTCTAACTTACAACACA
AGCTAATAAAAACGAGCTTTGTGTATCATGTTTATAAATATAACAAAAGA
GAGTCACTAGCAATTGTTAATGCAGCATCAATTGAATCGACAGAACCAAA
GCCAGAGCCAGAGCCAGAGCAAATTCCCGAAGTGGAAACTTATGGGAGAA
TTTTGTTATCTGATGTGTTGGTGAAGAGGAGAAGAAGTTTATTTTCTGGG
GGGAATTGGAACTCATTGGATATAAGCACAGCTGGTGTTGTTTTGGCAAT
GCATTTGCTTGCTCTCTTTGCGCCATTTTGTTTCACGTGGAGTTCTCTTA
GGGTTGCTTTTGGACTTTATGTTGTGACTGGACTTCTGGGTATCACTCTT
TCTTTTCACAGAAACCTTTCTCATAGGAGTTTTAAATTACCCAAATGGCT
TGAGTACTTGTTTGCTTATTGCGGAGTTCAGTCTCTTCAGGGGAATCCAA
TTGATTGGGTAAGCACACATAGGTATCATCACCAGTTTTGTGATTCCGAA
AGGGATCCGCATAGTCCCATTGAAGGGTTTTGGTTTAGTCACATGAGTTG
GCTGTTT
back to top