FC931163

Overview
NameFC931163
Unique NameFC931163
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9441 contig Ccv1_Contig9441:55..730. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931163 vs. ExPASy Swiss-Prot
Match: TIF3B_ARATH (Protein TIFY 3B OS=Arabidopsis thaliana GN=TIFY3B PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.021e-31
Identity = 76/163 (46.63%), Postives = 101/163 (61.96%), Query Frame = 2
Query:  182 VAQNDAGSAAGLDLSGNEVFNNTIRATAIPTSGVNATDLAPTQLTIFYGGKVCVFDAIPADKVREIMLIAASSATVTNTSDMKKDDTNCPASSPVLTRSPSLQSTASALASPRAQSYPVQRNLLCKLQAELPMARRHSLQRFFEKRRDRLVSKNPYPVQSEAK 670
            VA  D G+A        E   N +R+T I T+      + P QLTIF+GG V VFD +P++KV+EI+ IAA +    N++ +       P SSP L R+PS  ST++ +ASP AQ +P+Q    C+  A+LP+ARRHSLQRF EKRRDRLV+KNPYP     K
Sbjct:   18 VADGDGGAAEIGGTGSVEKSINEVRSTEIQTA---EPTVPPNQLTIFFGGSVTVFDGLPSEKVQEILRIAAKAMETKNSTSIS------PVSSPALNRAPSFSSTSN-VASPAAQPFPIQPISFCRSTADLPIARRHSLQRFLEKRRDRLVNKNPYPTSDFKK 170          
BLAST of FC931163 vs. ExPASy Swiss-Prot
Match: TIF3A_ARATH (Protein TIFY 3A OS=Arabidopsis thaliana GN=TIFY3A PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.833e-14
Identity = 52/118 (44.07%), Postives = 66/118 (55.93%), Query Frame = 2
Query:  296 LAPTQLTIFYGGKVCVFDAIPADKVREIMLIAASSATVTNTSDMKKDDTNCPASSPVLTRSPSLQSTASALASPRAQSYPVQRNLLCKLQAELPMARRHSLQRFFEKRRDRLVSKNPY 649
            + P+QLTI +GG   VFD IPA+KV+EI+ IAA+ A  T T        N  + +P L R+ S  S AS +A              C   A++P+ARR SLQRFFEKRR R V   PY
Sbjct:  127 ILPSQLTIIFGGSFSVFDGIPAEKVQEILHIAAA-AKATET-------INLTSINPALKRAISF-SNASTVA--------------CVSTADVPIARRRSLQRFFEKRRHRFVHTKPY 221          
BLAST of FC931163 vs. ExPASy Swiss-Prot
Match: TI10B_ARATH (Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10B PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.618e-14
Identity = 49/124 (39.52%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  311 LTIFYGGKVCVFDAIPADKVREIMLIAASSATVTNTSDMKKDDTNCPASSPVLTRSPSLQSTASALASPR--AQSYPVQRNLLCKLQAELPMARRHSLQRFFEKRRDRLVSKNPYPVQSEAKAS 676
            LTIFYGG+V VFD   A+K +E++ +A   +  + T    + + N  A S        + S+ + + SP   A   P+Q N    L  ELP+ARR SL RF EKR+DR+ SK PY +   A+AS
Sbjct:  120 LTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYS-----QKEIASSPNPVCSPAKTAAQEPIQPNP-ASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEAS 237          
BLAST of FC931163 vs. ExPASy Swiss-Prot
Match: TI11A_ARATH (Protein TIFY 11A OS=Arabidopsis thaliana GN=TIFY11A PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.130e-12
Identity = 47/123 (38.21%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  305 TQLTIFYGGKVCVFDAIPADKVREIMLIAASSATVT--NTSDMKKDDTNCPASSPVLTRSPSLQSTASALASPRAQSYPVQRNLLCKLQAELPMARRHSLQRFFEKRRDRLVSKNPYPVQSEA 667
            +QLTIF+GGKV V++  P DK +EIM +A  +  VT  N      D+ N   SS VL   P L          + Q    ++N + +      +ARR SL RFF KR+DR V++ PY V   A
Sbjct:   97 SQLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVL---PDLNEPTDNNHLTKEQQQQQEQNQIVE-----RIARRASLHRFFAKRKDRAVARAPYQVNQNA 211          
The following BLAST results are available for this feature:
BLAST of FC931163 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
TIF3B_ARATH4.021e-3146.63Protein TIFY 3B OS=Arabidopsis thaliana GN=TIFY3B ... [more]
TIF3A_ARATH5.833e-1444.07Protein TIFY 3A OS=Arabidopsis thaliana GN=TIFY3A ... [more]
TI10B_ARATH7.618e-1439.52Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10... [more]
TI11A_ARATH7.130e-1238.21Protein TIFY 11A OS=Arabidopsis thaliana GN=TIFY11... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102B07EF PostHarvP1 Citrus clementina cDNA clone C34102B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931163 ID=FC931163|Name=FC931163|organism=Citrus clementina|type=EST|length=676bp
GAAAGCAAAGGCGAGGAAGCTGCGAGAGAAAATTAAAAAAAATTGAAAAA
AATCGAAGAAGAAGAGGAAGGAGTCTGGAAATTTCTCGAGTTTAATTCAA
ATGGAGGAATTTGGGACTGTTGATGAAGTGAAGCCGAAGGCTGAGGCCGG
AATGGAAGTAGACGATAAGAAGAAGCATGAGGTTGCGCAAAACGACGCCG
GATCTGCTGCAGGGCTTGATTTGTCGGGGAACGAGGTGTTTAACAACACC
ATCAGGGCCACGGCAATCCCAACTTCTGGAGTGAATGCCACGGACCTTGC
TCCAACTCAGCTTACGATCTTCTATGGTGGAAAAGTGTGTGTATTTGATG
CCATTCCGGCAGACAAGGTTCGTGAAATTATGCTTATTGCTGCCTCTTCT
GCCACTGTTACTAACACAAGTGACATGAAGAAGGACGATACCAACTGTCC
TGCCTCTTCACCAGTTCTAACAAGGTCTCCTTCACTGCAAAGCACTGCAA
GTGCTTTGGCATCACCTCGGGCACAATCATATCCTGTTCAAAGGAATCTC
CTCTGCAAATTGCAAGCTGAACTACCAATGGCAAGGAGGCATTCCCTTCA
GCGATTTTTCGAGAAGCGACGTGACAGGCTGGTGAGCAAGAATCCATATC
CTGTTCAATCAGAGGCAAAAGCTTCT
back to top