FC931165

Overview
NameFC931165
Unique NameFC931165
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length756
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14318 contig Ccv1_Contig14318:132..887. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_RAT (Putative oxidoreductase GLYR1 OS=Rattus norvegicus GN=Glyr1 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.787e-57
Identity = 108/211 (51.18%), Postives = 147/211 (69.67%), Query Frame = 2
Query:  122 EVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++GFLGLG+MG  I  NLL+ G  VTVWNRT  KCD  +  GA +G +PAEV+  C IT   ++DP AA  +V    GVL+ I PGK  +DMSTVD +T  ++++ I S+GG FLEAPVSG++Q +  G LVIL+AG++ LY++  S    +GK +FFLGEVGN AKM L+VNM+ G  M T +EGL LA+ +G   +TLLD+L+ G +A+
Sbjct:  268 KIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLAS 478          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_CHICK (Putative oxidoreductase GLYR1 OS=Gallus gallus GN=GLYR1 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.787e-57
Identity = 108/211 (51.18%), Postives = 147/211 (69.67%), Query Frame = 2
Query:  122 EVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++GFLGLG+MG  I  NLL+ G  VTVWNRT  KCD  +  GA +G +PAEV+  C IT   ++DP AA  +V    GVL+ I PGK  +DMSTVD +T  ++++ I S+GG FLEAPVSG++Q +  G LVIL+AG++ LY++  S    +GK +FFLGEVGN AKM L+VNM+ G  M T +EGL LA+ +G   +TLLD+L+ G +A+
Sbjct:  269 KIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLAS 479          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_BOVIN (Putative oxidoreductase GLYR1 OS=Bos taurus GN=GLYR1 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.787e-57
Identity = 108/211 (51.18%), Postives = 147/211 (69.67%), Query Frame = 2
Query:  122 EVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++GFLGLG+MG  I  NLL+ G  VTVWNRT  KCD  +  GA +G +PAEV+  C IT   ++DP AA  +V    GVL+ I PGK  +DMSTVD +T  ++++ I S+GG FLEAPVSG++Q +  G LVIL+AG++ LY++  S    +GK +FFLGEVGN AKM L+VNM+ G  M T +EGL LA+ +G   +TLLD+L+ G +A+
Sbjct:  269 KIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLAS 479          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_HUMAN (Putative oxidoreductase GLYR1 OS=Homo sapiens GN=GLYR1 PE=1 SV=3)

HSP 1 Score: 219.935 bits (559), Expect = 1.158e-56
Identity = 108/211 (51.18%), Postives = 146/211 (69.19%), Query Frame = 2
Query:  122 EVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++GFLGLG+MG  I  NLL+ G  VTVWNRT  KCD  +  GA +G +PAEV+  C IT   ++DP AA  +V    GVL+ I PGK  +DMSTVD +T  ++++ I S+GG FLEAPVSG++Q +  G LVIL+AG++ LY++  S    +GK +FFLGEVGN AKM L+VNM+ G  M T +EGL LA  +G   +TLLD+L+ G +A+
Sbjct:  269 KIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLAS 479          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_XENTR (Putative oxidoreductase GLYR1 OS=Xenopus tropicalis GN=glyr1 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 9.800e-56
Identity = 106/211 (50.24%), Postives = 147/211 (69.67%), Query Frame = 2
Query:  122 EVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++GFLGLG+MG  I  NLL+ G  VTVWNRT  KCD  +  GA +G +PAEV+  C IT   +ADP AA  +V    GVL+ I PGK  +DMSTVD ET  ++++ I S+GG FLEAPVSG++Q +  G LVIL+AG++ +Y++  S    +GK +FFLGEVGN A+M L++NM+ G  M T +EG+ LA+ +G   +TLLD+L+ G +A+
Sbjct:  250 KIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGAHMGRTPAEVVSTCDITFACVADPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDPETVAELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDQGVYEDCSSCFLAMGKTSFFLGEVGNAARMMLILNMVQGSFMATIAEGMTLAQVTGQSQQTLLDILNQGQLAS 460          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_PONAB (Putative oxidoreductase GLYR1 OS=Pongo abelii GN=GLYR1 PE=2 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 2.183e-55
Identity = 106/211 (50.24%), Postives = 146/211 (69.19%), Query Frame = 2
Query:  122 EVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++GFLGLG+MG  I  NLL+ G  VTVW+RT  KCD  +  GA +G +PAEV+  C IT   ++DP AA  +V    GVL+ I P K  +DMSTVD +T  ++++ I S+GG FLEAPVSG++Q +  G LVIL+AG++ LY++  S    +GK +FFLGEVGN AKM L+VNM+ G  M T +EGL LA+ +G   +TLLD+L+ G +A+
Sbjct:  269 KIGFLGLGLMGSGIVSNLLKMGHTVTVWDRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPRKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLAS 479          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_DANRE (Putative oxidoreductase GLYR1 OS=Danio rerio GN=glyr1 PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.043e-53
Identity = 103/211 (48.82%), Postives = 145/211 (68.72%), Query Frame = 2
Query:  125 VGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFL-GEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            +GFLGLG+MG  +  NLL+ G  VTVWNRT  KCD  +  GA +G +PAEV+  C IT   ++DP AA  +V    GVL+ I PGK  ++MSTVD ET  ++S+ ITS+GG FLEAPVSGS+Q +  G LVI++AG++++Y++  S    +GK +FF+ GE GN A+M L++NM+ G  M T +EGL LA+ +G   +T LD+L  G +A+
Sbjct:  178 IGFLGLGLMGSGVVSNLLKMGHVVTVWNRTAEKCDLFIQEGARLGRTPAEVVSMCDITFSCVSDPKAARDLVLGPSGVLQGIRPGKCYVEMSTVDPETITELSQVITSRGGRFLEAPVSGSQQLSNDGMLVIVAAGDRSVYEDCSSCFQAMGKTSFFIAGEAGNAARMMLILNMVQGSFMATIAEGLTLAQATGQSQQTFLDILCQGQMAS 388          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_MOUSE (Putative oxidoreductase GLYR1 OS=Mus musculus GN=Glyr1 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.669e-53
Identity = 106/211 (50.24%), Postives = 144/211 (68.25%), Query Frame = 2
Query:  122 EVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++GFLGLG+MG  I  NLL+ G  VTVWNRT  K       GA +G +PAEV+  C IT   ++DP AA  +V    GVL+ I PGK  +DMSTVD +T  ++++ I S+GG FLEAPVSG++Q +  G LVIL+AG++ LY++  S    +GK +FFLGEVGN AKM L+VNM+ G  M T +EGL LA+ +G   +TLLD+L+ G +A+
Sbjct:  268 KIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEK------EGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLAS 472          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_AEDAE (Putative oxidoreductase GLYR1 homolog OS=Aedes aegypti GN=AAEL006684 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 4.127e-46
Identity = 92/212 (43.40%), Postives = 137/212 (64.62%), Query Frame = 2
Query:  119 MEVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            ++ GFLGLGIMG  +  NLL +G  V VWNRT +KC +    GA V  +P++VI+   +T   +ADP  A  +VF   GV+     GKG ++M+ VD ETS  I+  I +KGG +LEA + GSK  AE G L+IL+AGE+ L++E  +    I + +F++G+VGN  KM LV+ MI G M+   +EGL LA+++GL  + +L+VL+L  +++
Sbjct:  274 LKFGFLGLGIMGCGMVKNLLNSGHSVVVWNRTATKCRKFQEAGAEVADTPSDVIEMTDVTFSCVADPQVAKELVFGNCGVMSANLVGKGYVEMTGVDPETSHDIAEQIIAKGGRYLEAQIQGSKNQAEEGTLIILAAGERLLFEECQTCFEAISRNSFYMGDVGNATKMNLVLQMISGVMLAGIAEGLALADRAGLQQKDVLEVLELTSMSS 485          
BLAST of FC931165 vs. ExPASy Swiss-Prot
Match: GLYR1_ANOGA (Putative oxidoreductase GLYR1 homolog OS=Anopheles gambiae GN=AGAP009949 PE=3 SV=5)

HSP 1 Score: 179.874 bits (455), Expect = 1.328e-44
Identity = 91/233 (39.06%), Postives = 144/233 (61.80%), Query Frame = 2
Query:   56 VDLKSGKNLEHRGGRY*KNKKMEVGFLGLGIMGKAISMNLLRNGFKVTVWNRTLSKCDELVAHGATVGGSPAEVIKKCTITIGMLADPAAALSVVFDKGGVLEQICPGKGCIDMSTVDHETSIKISRAITSKGGHFLEAPVSGSKQPAETGQLVILSAGEKALYDEAISALNVIGKKAFFLGEVGNGAKMKLVVNMIMGCMMNTFSEGLVLAEKSGLDPRTLLDVLDLGGIAN 754
            +D+ S  N      R  K  +++ GFLGLG+MG  I  NL+++G  V VWNR+  KC +    GA V  +P++V++   +T   ++DP  A  +VF   GV+     GKG ++M+ VD ETS  I+ AI SKGG +LEA + GSK  AE G L+IL++G++ L++E  S    I + +F+LG+VGN  KM L++ MI G  +   +E + LA+++GL  + +L+VL+L  +++
Sbjct:  262 IDMSSVSNAVQ--SRNIKASQLKFGFLGLGVMGCGIVKNLIKSGHSVVVWNRSAHKCRKFQEVGAEVADTPSDVVEMTDVTYSCVSDPQVAKDMVFGNCGVMSANLAGKGYVEMTGVDPETSNDINEAIISKGGRYLEAQIQGSKNQAEEGTLIILASGDRLLFEECQSCFEAISRNSFYLGDVGNATKMNLILQMISGITLAGVAEAMALADRAGLQQKDVLEVLELTNMSS 492          
The following BLAST results are available for this feature:
BLAST of FC931165 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
GLYR1_RAT6.787e-5751.18Putative oxidoreductase GLYR1 OS=Rattus norvegicus... [more]
GLYR1_CHICK6.787e-5751.18Putative oxidoreductase GLYR1 OS=Gallus gallus GN=... [more]
GLYR1_BOVIN6.787e-5751.18Putative oxidoreductase GLYR1 OS=Bos taurus GN=GLY... [more]
GLYR1_HUMAN1.158e-5651.18Putative oxidoreductase GLYR1 OS=Homo sapiens GN=G... [more]
GLYR1_XENTR9.800e-5650.24Putative oxidoreductase GLYR1 OS=Xenopus tropicali... [more]
GLYR1_PONAB2.183e-5550.24Putative oxidoreductase GLYR1 OS=Pongo abelii GN=G... [more]
GLYR1_DANRE2.043e-5348.82Putative oxidoreductase GLYR1 OS=Danio rerio GN=gl... [more]
GLYR1_MOUSE2.669e-5350.24Putative oxidoreductase GLYR1 OS=Mus musculus GN=G... [more]
GLYR1_AEDAE4.127e-4643.40Putative oxidoreductase GLYR1 homolog OS=Aedes aeg... [more]
GLYR1_ANOGA1.328e-4439.06Putative oxidoreductase GLYR1 homolog OS=Anopheles... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102B09EF PostHarvP1 Citrus clementina cDNA clone C34102B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931165 ID=FC931165|Name=FC931165|organism=Citrus clementina|type=EST|length=756bp
GGATTAAAGATTCTTGCTTTATCTAAGTTTGGACTCTGCTGAGAGTTGCA
AGTAAGTAGATCTGAAAAGCGGAAAAAATTTAGAACACAGAGGAGGAAGA
TATTGAAAAAACAAGAAAATGGAAGTGGGGTTTCTGGGTTTAGGAATTAT
GGGCAAGGCCATTTCTATGAACTTGCTTAGAAATGGATTCAAAGTTACTG
TATGGAACAGGACTCTCTCTAAGTGTGATGAACTCGTGGCACACGGTGCT
ACAGTTGGAGGAAGTCCAGCAGAAGTAATTAAAAAGTGTACGATTACTAT
TGGGATGTTAGCTGATCCTGCGGCTGCACTTTCGGTTGTCTTTGACAAAG
GTGGTGTTTTGGAGCAAATTTGTCCTGGGAAAGGTTGCATTGACATGTCA
ACAGTTGATCATGAAACTTCAATAAAGATCAGCCGGGCAATTACATCAAA
AGGCGGTCACTTCCTTGAAGCTCCAGTTTCAGGTAGCAAGCAGCCTGCAG
AAACTGGTCAACTAGTAATCCTTTCTGCTGGGGAGAAGGCACTCTATGAT
GAAGCAATTTCAGCTCTCAATGTAATTGGAAAGAAGGCCTTCTTTTTGGG
GGAGGTCGGAAACGGAGCAAAAATGAAACTTGTTGTTAACATGATAATGG
GCTGTATGATGAATACATTTTCTGAAGGACTTGTACTGGCTGAAAAGAGT
GGACTTGACCCTCGCACTTTACTTGATGTACTGGACCTGGGTGGTATTGC
TAATCC
back to top