FC931167

Overview
NameFC931167
Unique NameFC931167
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length671
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: U172_ARATH (UPF0172 protein At5g55940 OS=Arabidopsis thaliana GN=EMB2731 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.103e-57
Identity = 109/138 (78.99%), Postives = 125/138 (90.58%), Query Frame = 3
Query:   93 GELKYELSQNAYIKLVLQARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQV 506
            GELKYE+SQNAYIKLVL + +HKTAAVNGVL+GR+SP++D VVEI+DSVPLFHS+L LLP LEISLIMIEEHY AQGL IVGYFHANERFDD+EL  +AKNIG+HI RYFPQ  +LLL+NKKLEAL KGK+RSPVMQ+
Sbjct:    7 GELKYEISQNAYIKLVLHSLRHKTAAVNGVLVGRISPKDDGVVEISDSVPLFHSNLALLPPLEISLIMIEEHYVAQGLSIVGYFHANERFDDVELCGVAKNIGDHISRYFPQAPILLLNNKKLEALSKGKERSPVMQL 144          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: F158A_RAT (UPF0172 protein FAM158A OS=Rattus norvegicus GN=Fam158a PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.318e-18
Identity = 51/129 (39.53%), Postives = 74/129 (57.36%), Query Frame = 3
Query:   90 MGELKYELSQNAYIKLVLQARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPK 476
            MGE+  E+S  AY K+ L A ++  AAVNG+LL   +   + +  + D VPLFHSHL L   LE++L  ++   +  GL + GY+HAN   DD     +A  I   I  +FP   +++LDNKKL   P+
Sbjct:    1 MGEV--EISARAYGKMCLHASRYPHAAVNGLLLAPATRSGECLC-LTDCVPLFHSHLALSVMLEVALNQVDVWATQAGLVVAGYYHANAVLDDQSPGPLALKIAGRIAEFFPNAVLIMLDNKKLVTWPR 126          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: F158A_MOUSE (UPF0172 protein FAM158A OS=Mus musculus GN=Fam158a PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.318e-18
Identity = 51/129 (39.53%), Postives = 75/129 (58.14%), Query Frame = 3
Query:   90 MGELKYELSQNAYIKLVLQARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPK 476
            MGE+  E+S  AY K+ L A ++  AAVNG+LL   +   + +  + D VPLFHSHL L   LE++L  ++   +  GL + GY+HAN   DD     +A  I   I  +FP+  +++LDNKKL   P+
Sbjct:    1 MGEV--EISARAYGKMCLHASRYPHAAVNGLLLAPATGSGECLC-LTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAVLDDQSPGPLALKIAGRIAEFFPRAVLIMLDNKKLVTRPR 126          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: F158A_HUMAN (UPF0172 protein FAM158A OS=Homo sapiens GN=FAM158A PE=2 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 8.541e-18
Identity = 49/129 (37.98%), Postives = 76/129 (58.91%), Query Frame = 3
Query:   90 MGELKYELSQNAYIKLVLQARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPK 476
            MGE+  E+S  AY+K+ L A ++  AAVNG+ L   +P++   + + D VPLFHSHL L   LE++L  ++   +  GL + GY+HAN   +D     +A  I   I  +FP   +++LDN+KL   P+
Sbjct:    1 MGEV--EISALAYVKMCLHAARYPHAAVNGLFLAP-APRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPR 126          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: U172_DROME (UPF0172 protein CG3501 OS=Drosophila melanogaster GN=CG3501 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.967e-15
Identity = 45/118 (38.14%), Postives = 69/118 (58.47%), Query Frame = 3
Query:  105 YELSQNAYIKLVLQARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSI-AKNIGNHICRYFPQCAVLLLDNK 455
            Y++S+ AY KL+  A K+   AVNG+LL   + +   V EI D++PLFH  L + P  E++L++I+ H   +GL I GY+ A E F D ++D   A  I + I   F     +++DNK
Sbjct:    4 YKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGSQV-EIVDAIPLFHQCLYVTPMAEVALMLIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAAKIADKIQENFKNACFVVVDNK 120          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: CX4NB_MOUSE (Neighbor of COX4 OS=Mus musculus GN=Cox4nb PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.411e-12
Identity = 41/124 (33.06%), Postives = 65/124 (52.42%), Query Frame = 3
Query:  108 ELSQNAYIKLVLQARKHKTAAVNGVLLG-RVSPQND------AVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKK 458
            +L+  AY K+VL   K+   AVNG+L+  R  P+ +      +     D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHGTLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFGDAALIMVDNAK 128          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: CX4NB_RAT (Neighbor of COX4 OS=Rattus norvegicus GN=Cox4nb PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.843e-12
Identity = 41/124 (33.06%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  108 ELSQNAYIKLVLQARKHKTAAVNGVLLG-RVSPQNDAV------VEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKK 458
            +L+  AY K+VL   K+   AVNG+L+  R  P+ +            D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGNHTLFVDCIPLFHGTLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDAALIMVDNAK 128          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: CX4NB_HUMAN (Neighbor of COX4 OS=Homo sapiens GN=COX4NB PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.105e-12
Identity = 40/127 (31.50%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  108 ELSQNAYIKLVLQARKHKTAAVNGVLLG-RVSPQNDAV---------VEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKK 458
            +L+  AY K+VL   K+   AVNG+L+  +  P+ + +             D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTK 131          
BLAST of FC931167 vs. ExPASy Swiss-Prot
Match: CX4NB_BOVIN (Neighbor of COX4 OS=Bos taurus GN=COX4NB PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.560e-11
Identity = 39/127 (30.71%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  108 ELSQNAYIKLVLQARKHKTAAVNGVLLG-RVSPQNDAV---------VEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKK 458
            +L+  AY K+VL   K+   AV+G+L+  +  P+ + +             D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVDGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTK 131          
The following BLAST results are available for this feature:
BLAST of FC931167 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
U172_ARATH1.103e-5778.99UPF0172 protein At5g55940 OS=Arabidopsis thaliana ... [more]
F158A_RAT1.318e-1839.53UPF0172 protein FAM158A OS=Rattus norvegicus GN=Fa... [more]
F158A_MOUSE1.318e-1839.53UPF0172 protein FAM158A OS=Mus musculus GN=Fam158a... [more]
F158A_HUMAN8.541e-1837.98UPF0172 protein FAM158A OS=Homo sapiens GN=FAM158A... [more]
U172_DROME3.967e-1538.14UPF0172 protein CG3501 OS=Drosophila melanogaster ... [more]
CX4NB_MOUSE1.411e-1233.06Neighbor of COX4 OS=Mus musculus GN=Cox4nb PE=1 SV... [more]
CX4NB_RAT1.843e-1233.06Neighbor of COX4 OS=Rattus norvegicus GN=Cox4nb PE... [more]
CX4NB_HUMAN4.105e-1231.50Neighbor of COX4 OS=Homo sapiens GN=COX4NB PE=1 SV... [more]
CX4NB_BOVIN1.560e-1130.71Neighbor of COX4 OS=Bos taurus GN=COX4NB PE=2 SV=1[more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102B11EF PostHarvP1 Citrus clementina cDNA clone C34102B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931167 ID=FC931167|Name=FC931167|organism=Citrus clementina|type=EST|length=671bp
TCATGACTATCAGACACTTGTGCGATTGATCGGCGATTCCGATAAATTTT
CAGCAACCCAGTGATCAGTCACAGAAAAATACGAAAATTATGGGCGAGTT
GAAATACGAATTGTCACAAAACGCCTACATAAAGCTAGTGCTACAAGCGC
GAAAGCACAAGACGGCGGCGGTCAACGGAGTCCTTCTGGGGCGAGTCTCT
CCTCAAAACGACGCTGTCGTCGAGATCGCCGACTCCGTCCCTCTCTTTCA
TTCCCACCTGGGCCTTCTCCCCAATCTCGAGATCTCCCTCATCATGATAG
AAGAGCATTATAGCGCTCAGGGTCTTGGCATTGTGGGGTATTTTCATGCA
AATGAGAGGTTTGATGACTTGGAGCTTGATAGCATTGCTAAGAATATTGG
CAATCACATTTGCCGGTACTTTCCTCAATGTGCTGTTCTCTTGTTAGATA
ACAAAAAGCTGGAAGCCTTACCTAAGGGGAAAGACCGGAGTCCTGTTATG
CAGGTTAGTGCTGTTTTTGTTTGCATAGAATTGTCTAATTACGGTGTGTC
TGTCAGCTTTTTGGCTATTAAAAGGTTTTGGTTGTGAATTATGTAAGATG
TTGTGTTATGTGAATGTTTCAGATTGATGCAAAATGATCACTGTGTATTA
AAATTTCTTTCTCTTATTATC
back to top