FC931169

Overview
NameFC931169
Unique NameFC931169
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP5_TOBAC (Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.567e-84
Identity = 153/173 (88.44%), Postives = 164/173 (94.80%), Query Frame = 1
Query:  187 MAGSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIR 705
            MAG+W+ R SL+V AIV FG LFA SIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTD ERLIGEAAKNQAAVNP+RTIFDVKRLIGRKF+DKEVQRD KL PY+IVN+DGKPYIQV+I+DGETKVFSPEEISAMILTKMKETAEA+LGKKI+
Sbjct:    1 MAGAWKRRASLIVFAIVLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQRDKKLVPYEIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIK 173          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP4_TOBAC (Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.826e-81
Identity = 148/171 (86.55%), Postives = 159/171 (92.98%), Query Frame = 1
Query:  193 GSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIR 705
            G+W  R SL+V  IV FG LFA SIA EEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTD ERLIGEAAKN AAVNP+RT+FDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+DGETK+FSPEEISAMILTKMKETAEA+LGKKI+
Sbjct:    4 GAWNRRTSLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTVFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKIFSPEEISAMILTKMKETAEAYLGKKIK 174          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP2_ARATH (Luminal-binding protein 2 OS=Arabidopsis thaliana GN=At5g42020 PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.188e-79
Identity = 150/173 (86.71%), Postives = 162/173 (93.64%), Query Frame = 1
Query:  187 MAGSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIR 705
            MA S+ A  S VVLAI+FFG LFA S AKEEATKLG+VIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWV FTDSERLIGEAAKNQAAVNP+RT+FDVKRLIGRKFEDKEVQ+D KL PY+IVN+DGKPYIQV+I+DGETKVFSPEEISAMILTKMKETAEA+LGKKI+
Sbjct:    1 MARSFGAN-STVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIK 172          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP1_ARATH (Luminal-binding protein 1 OS=Arabidopsis thaliana GN=At5g28540 PE=1 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 7.697e-79
Identity = 149/173 (86.13%), Postives = 162/173 (93.64%), Query Frame = 1
Query:  187 MAGSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIR 705
            MA S+ A  S VVLAI+FFG LFA+S A EEATKLG+VIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWV FTDSERLIGEAAKNQAAVNP+RT+FDVKRLIGRKFEDKEVQ+D KL PY+IVN+DGKPYIQV+I+DGETKVFSPEEISAMILTKMKETAEA+LGKKI+
Sbjct:    1 MARSFGAN-STVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIK 172          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP_SOLLC (Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.715e-78
Identity = 150/173 (86.71%), Postives = 158/173 (91.33%), Query Frame = 1
Query:  187 MAGSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIR 705
            MA   R   SLVVLAIV  G L A+S AKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTD+ERLIGEAAKN AAVNP+RTIFDVKRLIGRKFEDKEVQRDMKL PYKIV++DGKPYIQV+I+DGE KVFSPEEISAMILTKMKETAEAFLGK I+
Sbjct:    1 MAACSRRGNSLVVLAIVLLGCLSALSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVSKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIK 173          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP2_MAIZE (Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3)

HSP 1 Score: 290.041 bits (741), Expect = 8.510e-78
Identity = 143/167 (85.63%), Postives = 154/167 (92.22%), Query Frame = 1
Query:  202 RARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKI 702
            RARGS  +L ++  G LFA S+AKEE  KLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNP+RTIFDVKRLIGRKF DKEVQRDMKL PYKI+N+DGKPYIQV+I+DGE KVFSPEEISAMIL KMK+TAEA+LGKKI
Sbjct:    3 RARGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYKIINKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKI 169          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP3_MAIZE (Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.111e-77
Identity = 142/167 (85.03%), Postives = 154/167 (92.22%), Query Frame = 1
Query:  202 RARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKI 702
            R RGS  +L ++  G LFA S+AKEE  KLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKI+N+DGKPYIQV+I+DGE KVFSPEEISAMIL KMK+TAEA+LGKKI
Sbjct:    3 RVRGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKIINKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKI 169          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP_SPIOL (Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.229e-76
Identity = 141/173 (81.50%), Postives = 155/173 (89.60%), Query Frame = 1
Query:  187 MAGSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIR 705
            MA +W++R S +   IV  G LFA   AK+EA KLGTVIGIDLGTTYSCVGVYK+G VEIIANDQGNRITPSWVAFT+ ERLIGEAAKNQAA NP+RTIFDVKRLIGRKFEDKEVQ+DMKL PYKIVNRDGKPYIQV++++GETKVFSPEEISAMILTKMKETAE FLGKKI+
Sbjct:    1 MAVAWKSRASSIAFGIVLLGSLFAFVSAKDEAPKLGTVIGIDLGTTYSCVGVYKDGKVEIIANDQGNRITPSWVAFTNDERLIGEAAKNQAAANPERTIFDVKRLIGRKFEDKEVQKDMKLVPYKIVNRDGKPYIQVKVQEGETKVFSPEEISAMILTKMKETAETFLGKKIK 173          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: GRP78_NEUCR (78 kDa glucose-regulated protein homolog OS=Neurospora crassa GN=grp78 PE=3 SV=3)

HSP 1 Score: 212.231 bits (539), Expect = 2.255e-54
Identity = 105/169 (62.13%), Postives = 129/169 (76.33%), Query Frame = 1
Query:  196 SWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKI 702
            SW    S++    + F   F       +   +GTVIGIDLGTTYSCVGV + G VEI+ NDQGNRITPS+VAFTD ERL+G+AAKNQAA NP RTIFD+KRLIGRKF DK+VQ D+K  PYK+V++D KP ++V+++ GE K F+PEEISAMIL KMKETAE +LGKK+
Sbjct:    7 SWALGLSILGFFALLFSAGFVQQAHANDTEAMGTVIGIDLGTTYSCVGVMQKGKVEILVNDQGNRITPSYVAFTDEERLVGDAAKNQAAANPHRTIFDIKRLIGRKFSDKDVQNDIKHFPYKVVSKDDKPVVKVEVK-GEEKTFTPEEISAMILGKMKETAEGYLGKKV 174          
BLAST of FC931169 vs. ExPASy Swiss-Prot
Match: BIP2_DICDI (Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.847e-54
Identity = 107/162 (66.05%), Postives = 132/162 (81.48%), Query Frame = 1
Query:  217 LVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKI 702
            L +L ++ F    A    +EE    G+VIGIDLGTTYSCVGV+K G VEII NDQGNRITPS+VAFT++ERLIGEAAKNQA +NP+ TIFD+KRLIGR+F+D+EVQRDMKL PYKIV+++ KPY+ V+++ GE K +SPEEISAMIL +MKE AEA LGK +
Sbjct:    9 LCLLLLISFAA--AAEKKEEEKKDYGSVIGIDLGTTYSCVGVFKKGKVEIIPNDQGNRITPSYVAFTETERLIGEAAKNQATLNPENTIFDIKRLIGRRFDDEEVQRDMKLLPYKIVSKNNKPYVVVKVK-GEEKTYSPEEISAMILGRMKEIAEASLGKTV 167          
The following BLAST results are available for this feature:
BLAST of FC931169 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
BIP5_TOBAC3.567e-8488.44Luminal-binding protein 5 OS=Nicotiana tabacum GN=... [more]
BIP4_TOBAC2.826e-8186.55Luminal-binding protein 4 OS=Nicotiana tabacum GN=... [more]
BIP2_ARATH1.188e-7986.71Luminal-binding protein 2 OS=Arabidopsis thaliana ... [more]
BIP1_ARATH7.697e-7986.13Luminal-binding protein 1 OS=Arabidopsis thaliana ... [more]
BIP_SOLLC1.715e-7886.71Luminal-binding protein OS=Solanum lycopersicum PE... [more]
BIP2_MAIZE8.510e-7885.63Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=... [more]
BIP3_MAIZE1.111e-7785.03Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=... [more]
BIP_SPIOL1.229e-7681.50Luminal-binding protein OS=Spinacia oleracea GN=HS... [more]
GRP78_NEUCR2.255e-5462.1378 kDa glucose-regulated protein homolog OS=Neuros... [more]
BIP2_DICDI3.847e-5466.05Luminal-binding protein 2 OS=Dictyostelium discoid... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102C01EF PostHarvP1 Citrus clementina cDNA clone C34102C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931169 ID=FC931169|Name=FC931169|organism=Citrus clementina|type=EST|length=727bp
GGTGCACCCTATTTACACGTAAACCATCGGTCTATAAAGTGCTATCATTC
ACGCGCGATATTTCACTGAAACCAGAAGGCCTTTCGAAAGCAAAAAAACA
CACTTCAAACATCGAAACCTCCTCAATTGAACGAAGCTCTCTCAGAAAGG
AGTTTGAAGCAGGGTATAATTGCTGCAGTACGCGCGATGGCTGGCTCGTG
GAGAGCACGCGGGTCCCTCGTTGTGCTGGCGATTGTCTTCTTCGGAGGTC
TTTTTGCAATTTCAATTGCAAAAGAGGAAGCTACGAAGTTGGGAACGGTG
ATTGGGATAGATCTTGGTACAACTTATTCTTGTGTTGGTGTTTACAAGAA
TGGTCATGTCGAAATCATAGCCAATGATCAAGGAAACCGTATTACTCCAT
CATGGGTTGCATTCACTGACAGTGAGAGGTTGATCGGTGAGGCAGCAAAG
AATCAGGCTGCTGTCAATCCTGACAGGACCATCTTTGATGTCAAGAGACT
TATTGGAAGAAAGTTTGAGGACAAGGAGGTTCAGAGGGACATGAAGCTTG
CTCCTTACAAGATTGTGAATAGGGATGGAAAGCCTTATATTCAGGTTCAG
ATTAGGGACGGCGAGACCAAGGTCTTCAGTCCTGAGGAAATCAGTGCTAT
GATACTGACTAAGATGAAGGAGACAGCCGAGGCATTCCTTGGGAAGAAAA
TTAGGATGCTGTTGTCACTGGTCCTGC
back to top