FC931173

Overview
NameFC931173
Unique NameFC931173
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10325 contig Ccv1_Contig10325:95..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT1_GOSHI (ADP,ATP carrier protein 1, mitochondrial OS=Gossypium hirsutum GN=ANT1 PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.133e-98
Identity = 183/230 (79.57%), Postives = 193/230 (83.91%), Query Frame = 1
Query:   34 IDQVQHPSVMQKVAGQLLHSSLSQNIQDYE----RPTMYQRRGAYGNYSNAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAKLRRR 711
            +DQVQHPSVMQKVAGQL  SS SQ+ Q Y      P +YQRR AYGNYSNAA Q+P+   A  DLSMVPSTASAICVQAPAEKGF+ FAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRT+KDEG  +LWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGN             FVYSLDYARTRLANDAK  ++
Sbjct:    1 MDQVQHPSVMQKVAGQLFRSSHSQDFQGYNGSFRSPALYQRRAAYGNYSNAALQHPV--RAFGDLSMVPSTASAICVQAPAEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKK 228          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT1_ARATH (ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 3.904e-91
Identity = 165/228 (72.37%), Postives = 185/228 (81.14%), Query Frame = 1
Query:   31 MIDQVQHPSVMQKVAGQLLHSSLSQNIQ-DYERPTMYQRRGAYGNYSNAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAKLRRR 711
            M+DQVQHP++ QK AGQ + SS+S+++Q  Y+RP+MYQR   YGNYSNAAFQ+P  S       M+ +TAS + VQ P EKGF  FA+DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGIGDCF RT+KDEG  +LWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGN             FVYSLDYARTRLANDAK  ++
Sbjct:    1 MVDQVQHPTIAQKAAGQFMRSSVSKDVQVGYQRPSMYQRHATYGNYSNAAFQFPPTSR------MLATTASPVFVQTPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKK 222          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT2_ARATH (ADP,ATP carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=ANT2 PE=1 SV=2)

HSP 1 Score: 330.487 bits (846), Expect = 5.638e-90
Identity = 162/231 (70.13%), Postives = 189/231 (81.82%), Query Frame = 1
Query:   31 MIDQVQHPSVMQKVAGQLLHSSLSQNIQDY----ERPTMYQRRGAYGNYSNAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAKLRRR 711
            M++Q QHP+++QKV+GQLL SS+SQ+I+ Y    +RP  YQ+  AYGNYSNAAFQYP+V+A     S + +T S + VQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+GRL+EPYKGI DCF RT++DEGI +LWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKD+DGYWKWFAGN             FVYSLDYARTRLAND+K  ++
Sbjct:    1 MVEQTQHPTILQKVSGQLLSSSVSQDIRGYASASKRPATYQKHAAYGNYSNAAFQYPLVAA-----SQIATTTSPVFVQAPGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDSKSAKK 226          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT2_SOLTU (ADP,ATP carrier protein, mitochondrial (Fragment) OS=Solanum tuberosum GN=ANT1 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.201e-85
Identity = 163/227 (71.81%), Postives = 177/227 (77.97%), Query Frame = 1
Query:   46 QHPSVMQKVAGQL-LHSSLSQNIQ----DYERPTMYQRRGAYGNYSNAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAKLRRR 711
            QHP+V QKVA Q+ L SSLSQ++       +RP + QRR  YGNYSNA  Q      AT DLS++ + AS + VQAP EKG A FA DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGIGDCF RT+KDEG  ALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGN             FVYSLDYARTRLANDAK  ++
Sbjct:    4 QHPTVYQKVASQMHLSSSLSQDVHARYGGIQRPALSQRRFPYGNYSNAGLQ---TCQATQDLSLIAANASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFSRTIKDEGFAALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGGAGASSLLFVYSLDYARTRLANDAKAAKK 227          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT1_SOLTU (ADP,ATP carrier protein, mitochondrial OS=Solanum tuberosum GN=ANT PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.539e-84
Identity = 162/231 (70.13%), Postives = 178/231 (77.06%), Query Frame = 1
Query:   31 MIDQVQHPSVMQKVAGQL-LHSSLSQNIQDYE---RPTMYQRRGAYGNYSNAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAKLRRR 711
            M D  QHP+V QK A QL L SSLSQ++       +P +YQR  AYGNYSNA  Q      AT DLS++ S AS + VQAP EKGFA FA DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+GRLSEPYKGIG+CF RT+K+EG  +LWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGN             FVYSLDYARTRLAND K  ++
Sbjct:    1 MADMNQHPTVFQKAANQLDLRSSLSQDVHARYGGVQPAIYQRHFAYGNYSNAGLQR---GQATQDLSLITSNASPVFVQAPQEKGFAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLSEPYKGIGECFGRTIKEEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDRKASKK 228          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT1_MAIZE (ADP,ATP carrier protein 1, mitochondrial OS=Zea mays GN=ANT1 PE=2 SV=3)

HSP 1 Score: 277.33 bits (708), Expect = 5.664e-74
Identity = 147/227 (64.76%), Postives = 164/227 (72.25%), Query Frame = 1
Query:   31 MIDQVQHPSVMQKVAGQL-LHSSLSQNIQDYE---RPTMYQRRGAYGNYSNAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAK 699
            M DQ   P+V+ K+ GQ  L S +S+ ++        + Y+RR A  NY   +   P +S +      VP   + +C  APAEKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGI DCFKRT+KDEG  +LWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGN             FVYSLDYARTRLANDAK
Sbjct:    1 MADQANQPTVLHKLGGQFHLRSIISEGVRARNICPSVSSYERRFATRNYMTQSLWGPSMSVSGG--INVPVMQTPLCANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIVDCFKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDAK 225          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT2_MAIZE (ADP,ATP carrier protein 2, mitochondrial OS=Zea mays GN=ANT2 PE=2 SV=2)

HSP 1 Score: 274.248 bits (700), Expect = 4.795e-73
Identity = 148/227 (65.20%), Postives = 164/227 (72.25%), Query Frame = 1
Query:   31 MIDQVQHPSVMQKVAGQL-LHSSLSQNIQDYER-PTM--YQRRGAYGNYSNAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAK 699
            M DQ   P+V+ K+ GQ  L SS S+ ++     P+   Y+RR A  NY   +   P +S +      VP   + +   APAEKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGI DCFKRT+KDEG  +LWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGN             FVYSLDYARTRLANDAK
Sbjct:    1 MADQANQPTVLHKLGGQFHLSSSFSEGVRARNICPSFSPYERRFATRNYMTQSLWGPSMSVSGG--INVPVMPTPLFANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDAK 225          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT_ORYSJ (ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.909e-70
Identity = 144/232 (62.07%), Postives = 159/232 (68.53%), Query Frame = 1
Query:   31 MIDQVQHPSVMQKVAGQL-LHSSLSQNIQDYE---RPTMYQRRGAYGNYS-----NAAFQYPIVSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAK 699
            M +Q   P+V+QK  GQ  L SS S+ ++        + Y RR    +Y      N     P++S+            S I   APAEKG   F IDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGIGDCF RT+KDEG  +LWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKD+DGYWKWF GN             FVYSLDYARTRLANDAK
Sbjct:    1 MAEQANQPTVLQKFGGQFHLGSSFSEGVRARNICPSVSSYDRRFTTRSYMTQGLVNGGINVPMMSS------------SPIFANAPAEKGGKNFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDAK 220          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT1_WHEAT (ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.806e-65
Identity = 120/147 (81.63%), Postives = 126/147 (85.71%), Query Frame = 1
Query:  259 PAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAK 699
            P +KG   FAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGIGDCF RT+KDEG  +LWRGNTANVIRYFPTQALNFAFKDYFKR+FNFKKD+DGYWKWF GN             FVYSLDYARTRLANDAK
Sbjct:   23 PEKKGVKNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDAK 169          
BLAST of FC931173 vs. ExPASy Swiss-Prot
Match: ADT2_WHEAT (ADP,ATP carrier protein 2, mitochondrial OS=Triticum aestivum GN=ANT-G2 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 6.277e-65
Identity = 123/163 (75.46%), Postives = 133/163 (81.60%), Query Frame = 1
Query:  214 LSMVPSTASAICVQAPAEK-GFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLDYARTRLANDAK 699
            +S+   ++S +   AP EK G   FAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGIGDCF RT+KDEG  +LWRGNTANVIRYFPTQALNFAFKDYFKR+FNFKKD+DGYWKWF GN             FVYSLDY RTRLANDAK
Sbjct:    7 ISVPMMSSSPLFANAPPEKKGVKNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYGRTRLANDAK 169          
The following BLAST results are available for this feature:
BLAST of FC931173 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
ADT1_GOSHI1.133e-9879.57ADP,ATP carrier protein 1, mitochondrial OS=Gossyp... [more]
ADT1_ARATH3.904e-9172.37ADP,ATP carrier protein 1, mitochondrial OS=Arabid... [more]
ADT2_ARATH5.638e-9070.13ADP,ATP carrier protein 2, mitochondrial OS=Arabid... [more]
ADT2_SOLTU3.201e-8571.81ADP,ATP carrier protein, mitochondrial (Fragment) ... [more]
ADT1_SOLTU3.539e-8470.13ADP,ATP carrier protein, mitochondrial OS=Solanum ... [more]
ADT1_MAIZE5.664e-7464.76ADP,ATP carrier protein 1, mitochondrial OS=Zea ma... [more]
ADT2_MAIZE4.795e-7365.20ADP,ATP carrier protein 2, mitochondrial OS=Zea ma... [more]
ADT_ORYSJ2.909e-7062.07ADP,ATP carrier protein, mitochondrial OS=Oryza sa... [more]
ADT1_WHEAT4.806e-6581.63ADP,ATP carrier protein 1, mitochondrial OS=Tritic... [more]
ADT2_WHEAT6.277e-6575.46ADP,ATP carrier protein 2, mitochondrial OS=Tritic... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102C05EF PostHarvP1 Citrus clementina cDNA clone C34102C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931173 ID=FC931173|Name=FC931173|organism=Citrus clementina|type=EST|length=725bp
AATCTGTCATTTTTCAAAGGAAAAGTCACAATGATTGATCAGGTTCAACA
TCCTTCCGTCATGCAGAAGGTAGCTGGACAGCTCCTTCATTCCAGCCTTT
CCCAAAATATTCAGGATTATGAAAGGCCAACCATGTACCAAAGACGTGGT
GCTTATGGGAACTACTCCAATGCTGCATTCCAATACCCCATAGTCAGTGC
AGCTACAACCGATCTATCTATGGTGCCGTCAACTGCATCTGCTATTTGCG
TCCAAGCCCCAGCTGAGAAAGGCTTTGCAGGCTTTGCTATCGATTTCCTT
ATGGGTGGAGTTTCTGCTGCTGTGTCCAAAACAGCTGCTGCTCCCATTGA
GCGTGTTAAGCTTTTGATTCAAAACCAAGATGAGATGATCAAGAGTGGTA
GGCTATCTGAACCCTACAAGGGCATTGGTGATTGTTTTAAGCGTACAATG
AAGGATGAGGGTATTGTTGCTTTGTGGAGAGGAAATACCGCTAATGTTAT
CCGTTACTTCCCCACTCAGGCCCTGAACTTTGCATTCAAGGATTACTTCA
AGAGGCTCTTCAACTTCAAGAAAGACAGGGATGGTTACTGGAAATGGTTT
GCTGGTAATTTGGGATCAGGAGGTGCTGCTGGTGCTTCATCCCTTCTCTT
TGTTTACTCCTTGGACTATGCTCGTACCCGTCTGGCCAATGATGCCAAGC
TGCGAAGAAGGAGGGAGAGAGCATT
back to top